Ebola virus NP/Nucleoprotein Protein (His)
Based on 1 Customer Validation
The Ebola virus NP/nucleoprotein is critical for viral genome protection and replication, forming a helical capsid to protect the genome.The VP35 interaction stabilizes the monomeric NP, maintaining solubility until replication triggers cooperative binding to viral RNA.Ebola virus NP/Nucleoprotein Protein (His) is the recombinant Virus-derived Ebola virus NP/Nucleoprotein protein, expressed by E.coli , with N-His labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Ebola virus NP/nucleoprotein is critical for viral genome protection and replication, forming a helical capsid to protect the genome.The VP35 interaction stabilizes the monomeric NP, maintaining solubility until replication triggers cooperative binding to viral RNA.Ebola virus NP/Nucleoprotein Protein (His) is the recombinant Virus-derived Ebola virus NP/Nucleoprotein protein, expressed by E.coli , with N-His labeled tag.
Background
Ebola virus NP/Nucleoprotein Protein plays a pivotal role in viral genome protection and replication by oligomerizing into a helical capsid that encapsidates the viral genome, shielding it from cellular nucleases and the innate immune response. The interaction with VP35 stabilizes monomeric NP, maintaining its solubility until virus replication triggers the cooperative binding of NP to viral genomic RNA, leading to the release of VP35. This encapsidated genomic RNA, forming the nucleocapsid, serves as a template for transcription and replication, featuring a helical structure with a pitch of 10.81 NP per turn and a diameter of approximately 22nm. NP binds to six nucleotides of viral genomic RNA, with three exposed to the solvent and three hidden within the nucleocapsid. Furthermore, NP recruits the host PPP2R5C phosphatase to dephosphorylate VP30, promoting viral transcription. During virion assembly, NP interacts with VP24 and potentially host STAU1, facilitating nucleocapsid assembly and genome packaging. Additionally, interactions with VP40, host NXF1, and CCDC92 further contribute to the multifaceted functions of NP in the Ebola virus life cycle.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-His
-
Accession
AHX24646 (H630-Q739)
-
Gene ID/
-
Molecular Construction
-
N-term
-
His
-
EBOV NP (H630-Q739)
Accession # AHX24646 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein / NP Protein (His)
-
AA Sequence
HIQEARNQDSDNTQPEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNDENRFVTLDGQQFYWPVMNHRNKFMAILQHHQ
-
Predicted Molecular Mass
15.6 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 500 mM NaCl, pH 7.8.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
