Ebola virus NP/Nucleoprotein Protein (His)

The Ebola virus NP/nucleoprotein is critical for viral genome protection and replication, forming a helical capsid to protect the genome.The VP35 interaction stabilizes the monomeric NP, maintaining solubility until replication triggers cooperative binding to viral RNA.Ebola virus NP/Nucleoprotein Protein (His) is the recombinant Virus-derived Ebola virus NP/Nucleoprotein protein, expressed by E.coli , with N-His labeled tag.

Ebola virus NP/Nucleoprotein Protein plays a pivotal role in viral genome protection and replication by oligomerizing into a helical capsid that encapsidates the viral genome, shielding it from cellular nucleases and the innate immune response. The interaction with VP35 stabilizes monomeric NP, maintaining its solubility until virus replication triggers the cooperative binding of NP to viral genomic RNA, leading to the release of VP35. This encapsidated genomic RNA, forming the nucleocapsid, serves as a template for transcription and replication, featuring a helical structure with a pitch of 10.81 NP per turn and a diameter of approximately 22nm. NP binds to six nucleotides of viral genomic RNA, with three exposed to the solvent and three hidden within the nucleocapsid. Furthermore, NP recruits the host PPP2R5C phosphatase to dephosphorylate VP30, promoting viral transcription. During virion assembly, NP interacts with VP24 and potentially host STAU1, facilitating nucleocapsid assembly and genome packaging. Additionally, interactions with VP40, host NXF1, and CCDC92 further contribute to the multifaceted functions of NP in the Ebola virus life cycle.

Virus

E. coli

N-His

AHX24646 (H630-Q739)

/

Partial

HIQEARNQDSDNTQPEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNDENRFVTLDGQQFYWPVMNHRNKFMAILQHHQ

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.