ECM1 Protein, Human (HEK293, His)
ECM1 Protein, Human (HEK293, His) is the recombinant human-derived ECM1 protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ECM1 Protein, Human (HEK293, His) is the recombinant human-derived ECM1 protein, expressed by HEK293, with C-His tag.
Background
ECM1, a multifaceted protein, serves as a crucial participant in endochondral bone formation, acting as a negative regulator of bone mineralization. Beyond its role in bone development, ECM1 demonstrates its influence on vascular processes by stimulating endothelial cell proliferation and promoting angiogenesis. Furthermore, the protein exhibits inhibitory effects on MMP9 proteolytic activity, revealing its regulatory function in extracellular matrix remodeling. ECM1 engages in various molecular interactions, including binding to HSPG2 via its C-terminus and forming complexes with EFEMP1/FBLN3 and LAMB3. Additionally, ECM1 interacts directly with MMP9, emphasizing its involvement in the modulation of matrix metalloproteinase activity. The diverse roles and interactions of ECM1 underscore its significance in orchestrating processes related to bone formation and vascular function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q16610-1 (M1-E540)
-
Gene ID1893
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ECM1; Testicular Tissue Protein Li 61; Extracellular Matrix Protein 1; ECM1 Short Variant; Secretory Component P85; URBWD
-
AA Sequence
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
-
Predicted Molecular Mass
60.2 kDa
-
Molecular Weight
Approximately 80-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
