EDIL3 Protein, Human (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

EDIL3 Protein enhances endothelial cell adhesion by interacting with the alpha-v/beta-3 integrin receptor, while also inhibiting the formation of vascular-like structures. Its role suggests involvement in the regulation of vascular morphogenesis during embryonic development. EDIL3 Protein, Human (HEK293, His, solution) is the recombinant human-derived EDIL3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EDIL3 Protein enhances endothelial cell adhesion by interacting with the alpha-v/beta-3 integrin receptor, while also inhibiting the formation of vascular-like structures. Its role suggests involvement in the regulation of vascular morphogenesis during embryonic development. EDIL3 Protein, Human (HEK293, His, solution) is the recombinant human-derived EDIL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The EDIL3 Protein plays a pivotal role in promoting the adhesion of endothelial cells by interacting with the alpha-v/beta-3 integrin receptor. Concurrently, EDIL3 exerts an inhibitory effect on the formation of vascular-like structures, suggesting its regulatory role in processes related to angiogenesis. This protein is implicated in the intricate orchestration of vascular morphogenesis and remodeling during embryonic development, highlighting its significance in shaping the vascular architecture. The dynamic interplay between EDIL3 and the alpha-v/beta-3 integrin receptor underscores its potential as a key mediator in cellular adhesion and the regulation of vascular morphogenesis, contributing to our understanding of fundamental processes crucial for embryonic development.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EDIL3 (D24-E480)
      Accession # O43854-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    EDIL3; Developmentally-Regulated Endothelial Cell Locus 1 Protein; EGF Like And Discoidin Domains 3; EGF-Like Repeats And Discoidin I-Like Domains 3; DEL1; Integrin-Binding Protein DEL1; EGF Like Repeats And Discoidin Domains 3; Developmental Endothelial Locus-1; EGF-Like Repeat And Discoidin I-Like Domain-Containing Protein 3

  • AA Sequence

    DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

  • Predicted Molecular Mass

    53.1 kDa

  • Molecular Weight

    Approximately 55-68 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 300 mM NaCl, pH 8.0 or 20 mM Citrate, 6% Trehalose, 4% Mannitol, 100 mM NaCl, 0.05% Tween 80, pH 5.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00