1. Recombinant Proteins
  2. Others
  3. EDIL3 Protein, Human (HEK293, Fc)

EDIL3 Protein enhances endothelial cell adhesion by interacting with the alpha-v/beta-3 integrin receptor, while also inhibiting the formation of vascular-like structures. Its role suggests involvement in the regulation of vascular morphogenesis during embryonic development. EDIL3 Protein, Human (HEK293, Fc) is the recombinant human-derived EDIL3 protein, expressed by HEK293, with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
100 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

EDIL3 Protein enhances endothelial cell adhesion by interacting with the alpha-v/beta-3 integrin receptor, while also inhibiting the formation of vascular-like structures. Its role suggests involvement in the regulation of vascular morphogenesis during embryonic development. EDIL3 Protein, Human (HEK293, Fc) is the recombinant human-derived EDIL3 protein, expressed by HEK293, with C-hFc labeled tag.

Background

The EDIL3 Protein plays a pivotal role in promoting the adhesion of endothelial cells by interacting with the alpha-v/beta-3 integrin receptor. Concurrently, EDIL3 exerts an inhibitory effect on the formation of vascular-like structures, suggesting its regulatory role in processes related to angiogenesis. This protein is implicated in the intricate orchestration of vascular morphogenesis and remodeling during embryonic development, highlighting its significance in shaping the vascular architecture. The dynamic interplay between EDIL3 and the alpha-v/beta-3 integrin receptor underscores its potential as a key mediator in cellular adhesion and the regulation of vascular morphogenesis, contributing to our understanding of fundamental processes crucial for embryonic development.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O43854-1 (D24-E480)

Gene ID

10085

Molecular Construction
N-term
EDIL3 (D24-E480)
Accession # O43854-1
hFc
C-term
Protein Length

Full Length of Mature Peptide

Synonyms
EGF-Like Repeats and Discoidin I-Like Domains 3; EDIL3
AA Sequence

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

Predicted Molecular Mass
77.8 kDa.
분자량

80-90 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

EDIL3 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

EDIL3 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
EDIL3 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P704569
수량:
MCE Japan Authorized Agent: