Copy Link Print Information

EDNRB/Endothelin Receptor Type B Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

EDNRB/Endothelin Receptor Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin Receptor Type B Protein, Human (HEK293, His) is the recombinant human-derived EDNRB/Endothelin Receptor Type B Protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • EDNRB/Endothelin Receptor Type B Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

EDNRB/Endothelin Receptor Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin Receptor Type B Protein, Human (HEK293, His) is the recombinant human-derived EDNRB/Endothelin Receptor Type B Protein, expressed by HEK293 , with C-His labeled tag.

Background

EDNRB/Endothelin Receptor Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, operates by associating with G proteins to activate a phosphatidylinositol-calcium second messenger system. This molecular interaction mechanism underscores its pivotal role in mediating the cellular responses initiated by endothelin neuropeptides, highlighting the versatility of EDNRB in transducing signals that contribute to various physiological processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human EDNRB, at 5 μg/mL (100 μL/well) can bind Anti-EDNRB antibody. The ED50 for this effect is 1.836 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P24530/NP_000106.1 (E27-K101)

  • Gene ID
    1910  [NCBI]
  • Molecular Construction
    • N-term
    • EDNRB (E27-K101)
      Accession # P24530/NP_000106.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    EDNRB; ETRB; Prev. HSCR2; Hirschsprung Disease 2; Prev. HSCR; ABCDS; Endothelin Receptor Non-Selective Type; ETB1; ETB; ETBR; ET-BR; WS4A; ET-B; Endothelin Receptor Type B; Endothelin Receptor Subtype B1

  • AA Sequence

    EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK

  • Molecular Weight

    Approximately 16-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • EDNRB/Endothelin Receptor Type B Protein, Human (HEK293, His) Product Image
    1/16
  • EDNRB/Endothelin Receptor Type B Protein, Human (HEK293, His) Product Image