EDNRB/Endothelin R Type B Protein, Human (HEK293, His)

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, activates a phosphatidylinositol-calcium second messenger system through G proteins. This mechanism underscores its pivotal role in mediating cellular responses initiated by endothelin neuropeptides, emphasizing the versatility of EDNRB in transducing signals for various physiological processes. EDNRB/Endothelin R Type B Protein, Human (HEK293, His) is the recombinant human-derived EDNRB/Endothelin R Type B protein, expressed by HEK293 , with C-His labeled tag.

EDNRB/Endothelin R Type B Protein, a non-specific receptor for endothelin 1, 2, and 3, operates by associating with G proteins to activate a phosphatidylinositol-calcium second messenger system. This molecular interaction mechanism underscores its pivotal role in mediating the cellular responses initiated by endothelin neuropeptides, highlighting the versatility of EDNRB in transducing signals that contribute to various physiological processes.

Measured by its binding ability in a functional ELISA. Immobilized Human EDNRB, at 5 μg/mL (100 μL/well) can bind Anti-EDNRB antibody. The ED₅₀ for this effect is 1.836 ng/mL.

Human

HEK293

C-6*His

P24530/NP_000106.1 (E27-K101)

1910  [NCBI]

Extracellular Domain

EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK

Approximately 16-33 kDa due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.