EGFR Protein, Canine (sf9, His)

EGFR Protein is a receptor tyrosine kinase that binds to ligands of the EGF family. The high expression of EGFR protein can be used as a diagnostic marker for canine transitional cell carcinoma (TCC). EGFR Protein participate in the NF-kappa-B signaling pathway. The high expression of EGFR protein can be used as a diagnostic marker for canine transitional cell carcinoma (TCC). EGFR Protein, Canine (sf9, His) is the recombinant canine-derived EGFR protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of EGFR Protein, Canine (sf9, His) is 618 a.a., with molecular weight of ~87.2 kDa.

The EGFR protein, a receptor tyrosine kinase, binds ligands of the EGF family, including EGF, TGFA/TGF-alpha, AREG, epigen/EPGN, BTC/betacellulin, epiregulin/EREG, and HBEGF/heparin-binding EGF. This interaction initiates cascades that convert extracellular signals into cellular responses, involving receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2, activating downstream signaling cascades, including RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC, and STATs modules. Additionally, EGFR may trigger the NF-kappa-B signaling cascade and directly phosphorylate proteins like RGS16, activating its GTPase activity, and potentially linking EGF receptor signaling to G protein-coupled receptor signaling. Furthermore, EGFR phosphorylates MUC1, enhancing its interaction with SRC and CTNNB1/beta-catenin. It positively regulates cell migration through interaction with CCDC88A/GIV, retaining EGFR at the cell membrane post-ligand stimulation, thereby promoting EGFR signaling and triggering cell migration. Beyond its canonical functions, EGFR contributes to enhancing learning and memory performance and plays a role in mammalian pain signaling, with isoform 2 potentially acting as an antagonist to EGF action^{[1][2][3][4][5]}.

Canine

Sf9 insect cells

C-His

XP_533073.3 (M1-S618)

404306  [NCBI]

MAVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYMQRNYDLSFLKTIQEVAG YVLIALNTVEKIPLENLQIIRGNVLYENTHALSVLSNYGSNKTGLQELPLRNLHEILQGA VRFSNNPVLCNVETIQWRDIVDNDFISNMSMDIQNQAGRCQKCDPSCPNGSCWGPGKENC QKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPL MLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACSSDSYEVEEDGVRKCK KCEGPCRKVCNGIGIGEFKDTLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTLPL DPKELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVGLNITS LGLRSLKEISDGDVIISGNRKLCYANTINWKKLFGTSSQKTKIINNKDEKACKAIGHVCH PLCSSEGCWGPGPRDCVSCRNVSRGKECVEKCNILEGEPREFVENSECIQCHPECLPQAM NITCTGRGPDSCIKCAHYIDGPHCVKTCPAGIMGENNTLVWKFSDGSRMCHLCHPNCTYG CEGPGLEGCAKPGPKIPS

Approximately 87.2 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.