1. Recombinant Proteins
  2. Others
  3. ELK1 Protein, Human (sf9, His-GST)

The ELK1 protein is a transcription factor that binds to purine-rich DNA and forms a ternary complex with SRF on the serum response element. It induces transcription, especially upon stimulation of the JNK signaling pathway. ELK1 Protein, Human (sf9, His-GST) is the recombinant human-derived ELK1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ELK1 protein is a transcription factor that binds to purine-rich DNA and forms a ternary complex with SRF on the serum response element. It induces transcription, especially upon stimulation of the JNK signaling pathway. ELK1 Protein, Human (sf9, His-GST) is the recombinant human-derived ELK1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

The ELK1 protein serves as a transcription factor with an affinity for binding purine-rich DNA sequences. It forms a ternary complex with SRF and the ETS and SRF motifs present in the serum response element (SRE) on the promoter region of immediate early genes, including FOS and IER2. ELK1 induces the transcription of target genes, particularly in response to stimulation of the JNK-signaling pathway. In its sumoylated form, ELK1 interacts with PIAS2/PIASX, thereby enhancing its transcriptional activator activity. Additionally, ELK1 engages in a direct interaction with MAD2L2, promoting phosphorylation by the kinases MAPK8 and/or MAPK9. Furthermore, ELK1 interacts with POU1F1, highlighting its diverse associations in cellular processes and regulatory networks.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P19419-1 (M1-P428)

Gene ID
Molecular Construction
N-term
His-GST
ELK1 (M1-P428)
Accession # P19419-1
C-term
Protein Length

Full length

Synonyms
ETS domain-containing protein Elk-1; ELK1
AA Sequence

MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP

Molecular Weight

Approximately 73 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ELK1 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ELK1 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ELK1 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P74176
Quantity:
MCE Japan Authorized Agent: