ELK1 Protein, Human (sf9, His-GST)
The ELK1 protein is a transcription factor that binds to purine-rich DNA and forms a ternary complex with SRF on the serum response element. It induces transcription, especially upon stimulation of the JNK signaling pathway. ELK1 Protein, Human (sf9, His-GST) is the recombinant human-derived ELK1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ELK1 protein is a transcription factor that binds to purine-rich DNA and forms a ternary complex with SRF on the serum response element. It induces transcription, especially upon stimulation of the JNK signaling pathway. ELK1 Protein, Human (sf9, His-GST) is the recombinant human-derived ELK1 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
The ELK1 protein serves as a transcription factor with an affinity for binding purine-rich DNA sequences. It forms a ternary complex with SRF and the ETS and SRF motifs present in the serum response element (SRE) on the promoter region of immediate early genes, including FOS and IER2. ELK1 induces the transcription of target genes, particularly in response to stimulation of the JNK-signaling pathway. In its sumoylated form, ELK1 interacts with PIAS2/PIASX, thereby enhancing its transcriptional activator activity. Additionally, ELK1 engages in a direct interaction with MAD2L2, promoting phosphorylation by the kinases MAPK8 and/or MAPK9. Furthermore, ELK1 interacts with POU1F1, highlighting its diverse associations in cellular processes and regulatory networks.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P19419-1 (M1-P428)
-
Molecular Construction
-
N-term
-
His-GST
-
ELK1 (M1-P428)
Accession # P19419-1 -
C-term
-
-
Protein Length
Full length
-
Synonyms
ELK1; Tyrosine Kinase (ELK1) Oncogene; ETS Transcription Factor ELK1; ELK1, ETS Transcription Factor; ETS Domain-Containing Protein Elk-1; ETS-Like Gene 1; ELK1, Member Of ETS Oncogene Family
-
AA Sequence
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
-
Predicted Molecular Mass
73 kDa
-
Molecular Weight
Approximately 73 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
