1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. eltD Protein, Mycolicibacterium smegmatis 155

eltD Protein, Mycolicibacterium smegmatis 155

Cat. No.: HY-P701875
Handling Instructions Technical Support

The eltD protein is a key enzyme responsible for coordinating the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate, thereby forming gluconolactone. Notably, it is versatile, utilizing NAD(+) and NADP(+) as electron acceptors. eltD Protein, Mycolicibacterium smegmatis 155 is the recombinant eltD protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The eltD protein is a key enzyme responsible for coordinating the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate, thereby forming gluconolactone. Notably, it is versatile, utilizing NAD(+) and NADP(+) as electron acceptors. eltD Protein, Mycolicibacterium smegmatis 155 is the recombinant eltD protein, expressed by E. coli , with tag free.

Background

gdh2 protein plays a pivotal role in cellular metabolism by catalyzing the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate through the formation of gluconolactone. Remarkably versatile, it exhibits the ability to utilize both NAD(+) and NADP(+) as electron acceptors. Operating within the framework of the Entner-Doudoroff pathway, gdh2 is instrumental in the non-phosphorylative degradation of glucose. This multifaceted enzymatic activity underscores its importance in the cellular machinery responsible for glucose catabolism, contributing to the generation of metabolic intermediates essential for various cellular processes.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

A0QXD8 (S2-A362)

Gene ID

66734665

Molecular Construction
N-term
eltD (S2-A362)
Accession # A0QXD8
C-term
Protein Length

Full Length

Synonyms
eltD; Erythritol/L-threitol dehydrogenase
AA Sequence

SNQVPEKMQAVVCHGPHDYRLEEVAVPQRKPGEALIRVEAVGICASDLKCYHGAAKFWGDENRPAWAETMVIPGHEFVGRVVELDDEAAQRWGIAVGDRVVSEQIVPCWECLFCKRGQYHMCQPHDLYGFKRRTPGAMASYMVYPAEALVHKVSPDIPAQHAAFAEPLSCSLHAVERAQITFEDTVVVAGCGPIGLGMIAGAKAKSPMRVIALDMAPDKLKLAEKCGADLTINIAEQDAEKIIKDLTGGYGADVYIEGTGHTSAVPQGLNLLRKLGRYVEYGVFGSDVTVDWSIISDDKELDVLGAHLGPYCWPAAIKMIESGALPMDEICTHQFPLTEFQKGLDLVASGKESVKVSLIPA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

eltD Protein, Mycolicibacterium smegmatis 155 Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

eltD Protein, Mycolicibacterium smegmatis 155

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
eltD Protein, Mycolicibacterium smegmatis 155
Cat. No.:
HY-P701875
Quantity:
MCE Japan Authorized Agent: