eltD Protein, Mycolicibacterium smegmatis 155
The eltD protein is a key enzyme responsible for coordinating the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate, thereby forming gluconolactone. Notably, it is versatile, utilizing NAD(+) and NADP(+) as electron acceptors. eltD Protein, Mycolicibacterium smegmatis 155 is the recombinant eltD protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The eltD protein is a key enzyme responsible for coordinating the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate, thereby forming gluconolactone. Notably, it is versatile, utilizing NAD(+) and NADP(+) as electron acceptors. eltD Protein, Mycolicibacterium smegmatis 155 is the recombinant eltD protein, expressed by E. coli , with tag free.
Background
gdh2 protein plays a pivotal role in cellular metabolism by catalyzing the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate through the formation of gluconolactone. Remarkably versatile, it exhibits the ability to utilize both NAD(+) and NADP(+) as electron acceptors. Operating within the framework of the Entner-Doudoroff pathway, gdh2 is instrumental in the non-phosphorylative degradation of glucose. This multifaceted enzymatic activity underscores its importance in the cellular machinery responsible for glucose catabolism, contributing to the generation of metabolic intermediates essential for various cellular processes.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
A0QXD8 (S2-A362)
-
Gene ID66734665
-
Molecular Construction
-
N-term
-
eltD (S2-A362)
Accession # A0QXD8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Erythritol/L-threitol dehydrogenase; EC:1.1.1.-; eltD; MSMEG_3265; MSMEI_3181
-
AA Sequence
SNQVPEKMQAVVCHGPHDYRLEEVAVPQRKPGEALIRVEAVGICASDLKCYHGAAKFWGDENRPAWAETMVIPGHEFVGRVVELDDEAAQRWGIAVGDRVVSEQIVPCWECLFCKRGQYHMCQPHDLYGFKRRTPGAMASYMVYPAEALVHKVSPDIPAQHAAFAEPLSCSLHAVERAQITFEDTVVVAGCGPIGLGMIAGAKAKSPMRVIALDMAPDKLKLAEKCGADLTINIAEQDAEKIIKDLTGGYGADVYIEGTGHTSAVPQGLNLLRKLGRYVEYGVFGSDVTVDWSIISDDKELDVLGAHLGPYCWPAAIKMIESGALPMDEICTHQFPLTEFQKGLDLVASGKESVKVSLIPA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
