EpCAM/TROP1 Protein, Human (HEK293, mFc)
EpCAM/TROP1 Protein, Human (HEK293, mFc) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293, with C-mFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EpCAM/TROP1 Protein, Human (HEK293, mFc) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293, with C-mFc tag.
Background
The EpCAM/TROP1 protein serves a multifaceted role, potentially acting as a physical homophilic interaction molecule that facilitates direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium. This interaction suggests a pivotal function in establishing an immunological barrier, serving as the first line of defense against mucosal infections. Beyond its involvement in mucosal immunity, EpCAM/TROP1 plays a significant role in the proliferation and differentiation of embryonic stem cells. Moreover, it exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricacies of its molecular interactions, shedding light on its diverse functions in cellular physiology.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
AAH14785.1 (Q24-K265)
-
Gene ID4072
-
Molecular Construction
-
N-term
-
EpCAM (Q24-K265)
Accession # AAH14785.1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EPCAM; HEA125; Prev. TACSTD1; CO-17A; Prev. MIC18; EGP314; Prev. M4S1; EGP34; Tumor-Associated Calcium Signal Transducer 1; CD326; TROP1; MOC31; KSA; 17-1A; GA733-2; Ly74; Ber-Ep4; MH99; Ep-CAM; Membrane Component, Chromosome 4, Surface Marker (35kD Glycoprotein); MOC-31; Antigen Identified By Monoclonal Antibody AUA1; BerEp4; Human Epithelial Glycoprotein-2; EGP40; Epithelial Cell Surface Antigen; EGP-2; Epithelial Glycoprotein; KS1/4; KS 1/4 Antigen; MK-1; CD326 Antigen; ESA; HEGP314; Major Gastrointestinal Tumor-Associated Protein GA733-2; HNPCC8; Trophoblast Cell Surface Antigen 1; LYNCH8; Adenocarcinoma-Associated Antigen; DIAR5; Cell Surface Glycoprotein Trop-1; M1S2; Epithelial Glycoprotein 314; EGP; TACST-1; Epithelial Cell Adhesion Molecule; 323/A3
-
AA Sequence
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
-
Predicted Molecular Mass
54.3 kDa
-
Molecular Weight
Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
