1. Recombinant Proteins
  2. CD Antigens
  3. Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD326/EpCAM
  5. EpCAM/TROP1 Protein, Human (HEK293, mFc)

EpCAM/TROP1 Protein, Human (HEK293, mFc) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293, with C-mFc tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EpCAM/TROP1 Protein, Human (HEK293, mFc) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293, with C-mFc tag.

Background

The EpCAM/TROP1 protein serves a multifaceted role, potentially acting as a physical homophilic interaction molecule that facilitates direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium. This interaction suggests a pivotal function in establishing an immunological barrier, serving as the first line of defense against mucosal infections. Beyond its involvement in mucosal immunity, EpCAM/TROP1 plays a significant role in the proliferation and differentiation of embryonic stem cells. Moreover, it exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricacies of its molecular interactions, shedding light on its diverse functions in cellular physiology.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

AAH14785.1 (Q24-K265)

Gene ID

4072

Molecular Construction
N-term
EpCAM (Q24-K265)
Accession # AAH14785.1
mFc
C-term
Synonyms
rHuEpithelial cell adhesion molecule/EpCAM, His; Epithelial Cell Adhesion Molecule; Ep-CAM; Adenocarcinoma-Associated Antigen; Cell Surface Glycoprotein Trop-1; Epithelial Cell Surface Antigen; Epithelial Glycoprotein; EGP; Epithelial Glycoprotein 314; EGP314; hEGP314; KSA; Tumor-Associated Calcium Signa
AA Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Predicted Molecular Mass
54.3 kDa.
Molecular Weight

60-65 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EpCAM/TROP1 Protein, Human (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EpCAM/TROP1 Protein, Human (HEK293, mFc)
Cat. No.:
HY-P704581
Quantity:
MCE Japan Authorized Agent: