EPCR Protein, Rat (HEK293, His)
Based on 1 Customer Validation
EPCR Protein plays a pivotal role in blood coagulation by binding to and enhancing the activation of protein C through interaction with the thrombin-thrombomodulin complex. Its significance lies in regulating coagulation processes and modulating protein C activation, a crucial factor in anticoagulant mechanisms. EPCR Protein, Rat (HEK293, His) is the recombinant rat-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
EPCR Protein plays a pivotal role in blood coagulation by binding to and enhancing the activation of protein C through interaction with the thrombin-thrombomodulin complex. Its significance lies in regulating coagulation processes and modulating protein C activation, a crucial factor in anticoagulant mechanisms. EPCR Protein, Rat (HEK293, His) is the recombinant rat-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.
Background
The EPCR protein exhibits a pivotal role in blood coagulation by binding to activated protein C and enhancing its activation through interaction with the thrombin-thrombomodulin complex. This participation in the protein C pathway underscores EPCR's significance in regulating coagulation processes, highlighting its ability to modulate the activation of protein C, a key factor in anticoagulant mechanisms.
Verified Bioactivity
Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Rat EPCR. The ED50 for this effect is 0.2630 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
Q4V8I1 (N21-S213)
-
Molecular Construction
-
N-term
-
EPCR (N21-S213)
Accession # Q4V8I1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PROCR; Protein C Receptor, Endothelial; Protein C Receptor; CD201 Antigen; EPCR; APC Receptor; Endothelial Protein C Receptor; CD201; Activated Protein C Receptor; Cell Cycle, Centrosome-Associated Protein; CCD41; Centrocyclin; Endothelial Cell Protein C
-
AA Sequence
NSDGSQSLHMLQISYFPDPYHGRHQGNASLGKLLTHTLEGPSNNVTILQLQDWQDPDSWARTESGLKIYLSQFNSLVQLIYRERKNDVVFPLTVSCSVGCELPPEEGSEPHVFFDVAVNGSAFVSFQPKTAIWVTGSQEPSEAINFTLKQLNTYNRTRYELQEFLQDTCVQYLENHITTQNTKGSQTGRSYTS
-
Molecular Weight
Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)