1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Endothelial cell CD Proteins
  4. CD201/Activated Protein C Receptor
  5. EPCR Protein, Rat (HEK293, His)

EPCR Protein plays a pivotal role in blood coagulation by binding to and enhancing the activation of protein C through interaction with the thrombin-thrombomodulin complex. Its significance lies in regulating coagulation processes and modulating protein C activation, a crucial factor in anticoagulant mechanisms. EPCR Protein, Rat (HEK293, His) is the recombinant rat-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EPCR Protein plays a pivotal role in blood coagulation by binding to and enhancing the activation of protein C through interaction with the thrombin-thrombomodulin complex. Its significance lies in regulating coagulation processes and modulating protein C activation, a crucial factor in anticoagulant mechanisms. EPCR Protein, Rat (HEK293, His) is the recombinant rat-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

Background

The EPCR protein exhibits a pivotal role in blood coagulation by binding to activated protein C and enhancing its activation through interaction with the thrombin-thrombomodulin complex. This participation in the protein C pathway underscores EPCR's significance in regulating coagulation processes, highlighting its ability to modulate the activation of protein C, a key factor in anticoagulant mechanisms.

Biological Activity

Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Rat EPCR. The ED50 for this effect is 0.2630 μg/mL.

  • Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Rat EPCR. The ED50 for this effect is 0.2630 μg/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q4V8I1 (N21-S213)

Gene ID
Molecular Construction
N-term
EPCR (N21-S213)
Accession # Q4V8I1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Endothelial Protein C Receptor; CD201; PROCR; EPCR
AA Sequence

NSDGSQSLHMLQISYFPDPYHGRHQGNASLGKLLTHTLEGPSNNVTILQLQDWQDPDSWARTESGLKIYLSQFNSLVQLIYRERKNDVVFPLTVSCSVGCELPPEEGSEPHVFFDVAVNGSAFVSFQPKTAIWVTGSQEPSEAINFTLKQLNTYNRTRYELQEFLQDTCVQYLENHITTQNTKGSQTGRSYTS

Molecular Weight

Approximately 30-40 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EPCR Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EPCR Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EPCR Protein, Rat (HEK293, His)
Cat. No.:
HY-P75244
Quantity:
MCE Japan Authorized Agent: