EphB1 Protein, Human (Active, sf9, His)
The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1, Human (Active, sf9, His) is the recombinant human-derived EphB1 protein, expressed by E. coli, with N-Avi labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The EphB1 protein is a receptor tyrosine kinase that promiscuously binds to the transmembrane ephrin-B ligand of adjacent cells, initiating bidirectional signaling. The forward signal originates from the receptor and the reverse signal originates from the ephrin ligand. EphB1, Human (Active, sf9, His) is the recombinant human-derived EphB1 protein, expressed by E. coli, with N-Avi labeled tag.
Background
The EphB1 protein, a receptor tyrosine kinase, engages in promiscuous binding to transmembrane ephrin-B family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the signaling pathway downstream of the ephrin ligand is termed reverse signaling. Cognate/functional ephrin ligands for this receptor include EFNB1, EFNB2, and EFNB3. In nervous system development, EphB1 regulates retinal axon guidance by redirecting ipsilaterally ventrotemporal retinal ganglion cell axons at the optic chiasm midline, likely through repulsive interaction with EFNB2. In the adult nervous system, in conjunction with EFNB3, EphB1 governs chemotaxis, proliferation, and polarity of hippocampal neural progenitors. Beyond its role in axon guidance, EphB1 plays a crucial redundant role with other ephrin-B receptors in the development and maturation of dendritic spines and synapse formation. Additionally, EphB1 may regulate angiogenesis and, more generally, play a role in targeted cell migration and adhesion. Upon activation by EFNB1 and possibly other ephrin-B ligands, EphB1 activates the MAPK/ERK and JNK signaling cascades to regulate cell migration and adhesion, respectively. Moreover, EphB1 is involved in maintaining the pool of satellite cells (muscle stem cells) by promoting their self-renewal and reducing their activation and differentiation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P54762-1 (D602-A896)
-
Gene ID2047
-
Molecular Construction
-
N-term
-
His
-
(D602-A896)
Accession # P54762-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
EPHB1; ELK; Prev. EPHT2; EK6; Hek6; Receptor Protein-Tyrosine Kinase; Neuronally-Expressed EPH-Related Tyrosine Kinase; Eph Tyrosine Kinase 2; Tyrosine-Protein Kinase Receptor EPH-2; EPH Tyrosine Kinase 2; Ephrin Type-B Receptor 1; EphB1; EPH-Like Kinase
-
AA Sequence
DPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITA
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)