1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators Kinases
  3. Ephrin/Eph Family Receptor Tyrosine Kinases Transferases (EC 2) Protein Tyrosine Kinases Pseudokinases TK
  4. Eph Receptors Eph
  5. EphB3
  6. EphB3 Protein, Human (Active, sf9)

The EphB3 protein is a receptor tyrosine kinase that performs bidirectional signaling with the transmembrane ephrin B ligand. It participates in forward signaling and reverse signaling, sharing functionality with EPHB2. EphB3 Protein, Human (Active, sf9) is the recombinant human-derived EphB3, expressed by Sf9 insect cells, with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EphB3 protein is a receptor tyrosine kinase that performs bidirectional signaling with the transmembrane ephrin B ligand. It participates in forward signaling and reverse signaling, sharing functionality with EPHB2. EphB3 Protein, Human (Active, sf9) is the recombinant human-derived EphB3, expressed by Sf9 insect cells, with tag-free.

Background

The EphB3 protein is a receptor tyrosine kinase that engages in contact-dependent bidirectional signaling with adjacent cells by binding to transmembrane ephrin-B family ligands. This receptor is involved in both forward signaling, downstream of the receptor, and reverse signaling, downstream of the ephrin ligand. EphB3 shares overlapping and redundant functions with EPHB2, particularly in axon guidance during development, where it regulates the formation of interhemispheric connections in the cerebral cortex. Additionally, EphB3 contributes to the development and maturation of dendritic spines and excitatory synapses, as well as controls cell migration and positioning in various developmental processes such as angiogenesis, palate development, and thymic epithelium development. The EFNB2/EPHB3 complex also plays a role in regulating migration and adhesion of cells involved in the tubularization of the urethra and septation of the cloaca. Lastly, EphB3 is crucial for intestinal epithelium differentiation, distinguishing progenitor cells from differentiated cells within the crypt.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

P54753 (K596-V998)

Gene ID

2049

Protein Length

Partial

Synonyms
EPHB3; EPH receptor B3; EK2; ETK2; HEK2; TYRO6
AA Sequence

KLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EphB3 Protein, Human (Active, sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EphB3 Protein, Human (Active, sf9)
Cat. No.:
HY-P702711
Quantity:
MCE Japan Authorized Agent: