EphB3 Protein, Human (Active, sf9)

The EphB3 protein is a receptor tyrosine kinase that performs bidirectional signaling with the transmembrane ephrin B ligand. It participates in forward signaling and reverse signaling, sharing functionality with EPHB2. EphB3 Protein, Human (Active, sf9) is the recombinant human-derived EphB3, expressed by Sf9 insect cells, with tag-free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The EphB3 protein is a receptor tyrosine kinase that performs bidirectional signaling with the transmembrane ephrin B ligand. It participates in forward signaling and reverse signaling, sharing functionality with EPHB2. EphB3 Protein, Human (Active, sf9) is the recombinant human-derived EphB3, expressed by Sf9 insect cells, with tag-free.

Background

The EphB3 protein is a receptor tyrosine kinase that engages in contact-dependent bidirectional signaling with adjacent cells by binding to transmembrane ephrin-B family ligands. This receptor is involved in both forward signaling, downstream of the receptor, and reverse signaling, downstream of the ephrin ligand. EphB3 shares overlapping and redundant functions with EPHB2, particularly in axon guidance during development, where it regulates the formation of interhemispheric connections in the cerebral cortex. Additionally, EphB3 contributes to the development and maturation of dendritic spines and excitatory synapses, as well as controls cell migration and positioning in various developmental processes such as angiogenesis, palate development, and thymic epithelium development. The EFNB2/EPHB3 complex also plays a role in regulating migration and adhesion of cells involved in the tubularization of the urethra and septation of the cloaca. Lastly, EphB3 is crucial for intestinal epithelium differentiation, distinguishing progenitor cells from differentiated cells within the crypt.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    EPHB3; Embryonic Kinase 2; Prev. ETK2; Human Embryo Kinase 2; Tyro6; EPH-Like Kinase 2; Hek2; EphB3; Tyrosine-Protein Kinase TYRO6; TYRO6; EPH-Like Tyrosine Kinase 2; HEK2; Ephrin Type-B Receptor 3; EPH Receptor B3; EK2

  • AA Sequence

    KLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00