ETV4 Protein, Human (His, Strep)
Based on 1 Customer Validation
ETV4 Protein, Human (His, Strep) is the recombinant human-derived ETV4, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ETV4 Protein, Human (His, Strep) is the recombinant human-derived ETV4, expressed by E. coli , with Strep, His labeled tag.
ETV4 is a transcriptional activator that may play a role in keratinocyte differentiation. During microbial infection, ETV4 binds to the enhancer of the adenovirus E1A gene and acts as a transcriptional activator, with the core-binding sequence being 5'-[AC]GGA[AT]GT-3'. by similar: The role of ETV4 in keratinocyte differentiation (PubMed:31552090).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-StrepⅡ
-
Accession
P43268-1 (R338-A470)
-
Gene ID2118
-
Protein Length
Partial
-
Synonyms
ETV4; ETS Translocation Variant 4; ETS Variant Transcription Factor 4; CDNA FLJ55351, Highly Similar To ETS Translocation Variant 4; E1A-F; EWS Protein/E1A Enhancer Binding Protein Chimera; E1AF; E1A Enhancer Binding Protein; PEA3; ETS Variant 4; Ets Vari
-
AA Sequence
RGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELA
-
Predicted Molecular Mass
18.6 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES , pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
