FABP1/L-FABP Protein, Mouse (His)
Based on 1 Customer Validation
FABP1/L-FABP Protein facilitates cholesterol uptake in hepatocytes via lipoproteins, binding cholesterol, free fatty acids, coenzyme A derivatives, bilirubin, and small molecules within the cytoplasm. It may also participate in intracellular lipid transport processes. FABP1/L-FABP Protein, Mouse (His) is the recombinant mouse-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FABP1/L-FABP Protein facilitates cholesterol uptake in hepatocytes via lipoproteins, binding cholesterol, free fatty acids, coenzyme A derivatives, bilirubin, and small molecules within the cytoplasm. It may also participate in intracellular lipid transport processes. FABP1/L-FABP Protein, Mouse (His) is the recombinant mouse-derived FABP1/L-FABP protein, expressed by E. coli , with N-6*His labeled tag.
Background
The FABP1/L-FABP protein plays a crucial role in facilitating the uptake of cholesterol by hepatocytes through lipoproteins. It has the ability to bind cholesterol, as well as other molecules like free fatty acids and their coenzyme A derivatives, bilirubin, and various small molecules within the cytoplasm. Moreover, there is a potential involvement of FABP1/L-FABP in intracellular lipid transport processes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P12710 (M1-I127)
-
Molecular Construction
-
N-term
-
6*His
-
FABP1 (M1-I127)
Accession # P12710 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FABP1; Fatty Acid-Binding Protein, Liver; Fatty Acid Binding Protein 1; Fatty Acid Binding Protein 1, Liver; L-FABP; FABPL; Liver-Type Fatty Acid-Binding Protein; Fatty Acid-Binding Protein 1
-
AA Sequence
MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or PBS, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
