FABP3 Protein, Human
Based on 1 Customer Validation
FABP3 Protein, Human is the recombinant human-derived FABP3 protein, expressed by E. coli, with tag free tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
FABP3 Protein, Human is the recombinant human-derived FABP3 protein, expressed by E. coli, with tag free tag.
Background
H-FABP is a fatty acid-binding protein believed to be involved in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. by similar: Other FABPs share similar functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P05413 (M1-A133)
-
Gene ID2170
-
Molecular Construction
-
N-term
-
FABP3 (M1-A133)
Accession # P05413 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FABP3; Heart-Type Fatty Acid-Binding Protein; Prev. FABP11; Muscle Fatty Acid-Binding Protein; Prev. MDGI; Fatty Acid Binding Protein 11; H-FABP; M-FABP; Mammary-Derived Growth Inhibitor; Fatty Acid Binding Protein 3, Muscle And Heart (Mammary-Derived Gro
-
AA Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
-
Predicted Molecular Mass
14.9 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)