1. Recombinant Proteins
  2. Others
  3. FABP7 Protein, Human

FABP7 Protein, Human expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FABP7 Protein, Human expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms[1].

Background

FABP-7 is a well-known marker of neural stem cells and radial glia in the CNS. In the embryonic brain, FABP7 is essential for the maintenance and proliferation of neural stem-progenitor cells and radial glia[2].

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O15540-1 (M1-A132)

Gene ID

2173

Protein Length

Full Length of Isoform-1

Synonyms
rHuFABP7, His; Fatty Acid-Binding Protein Brain; B-FABP; Brain-Type Fatty Acid-Binding Protein
AA Sequence

MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Predicted Molecular Mass
14.9 kDa
Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FABP7 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FABP7 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP7 Protein, Human
Cat. No.:
HY-P701310
Quantity:
MCE Japan Authorized Agent: