Fas/CD95 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD). Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases. Rat Fas receptor contain a death domain (219-303 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Rat (HEK293, His) has a full length of 149 amino acids (Q22-K170), produced in HEK293 cells with C-terminal 6*His-tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Fas receptor is a cell surface death receptor, can bind to Fas ligand to form death-inducing signaling complexes, such as Fas associated death domain proteins (FADD)[1][2]. Fas receptor participates in the caspase cascade and regulate the activation of JNK and p38-K downstream. It is also involved in the signaling cascade of ERK/JNK MAPKs, activating MAPK3/ERK1, MAPK8/JNK and NF-κB, which has been implicated in the pathogenesis of various malignant tumors and immune system diseases[3][4]. Rat Fas receptor contain a death domain (219-303 a.a.) that plays a key role in regulating programmed death. Fas/CD95 Protein, Rat (HEK293, His) has a full length of 149 amino acids (Q22-K170), produced in HEK293 cells with C-terminal 6*His-tag.

Background

Fas receptor is the receptor for TNFSF6/FASLG, also known as apoptosis-mediating surface antigen FAS and Apo-1 antigen. It is a cell-surface protein that mediates apoptosis upon ligation with Fas ligand. Fas receptor belongs to tumor necrosis factor receptor superfamily, there are 7 isoforms produced by alternative splicing, some of which are candidates for nonsense-mediated mRNA decay (NMD). The Fas gene is expressed in several tissues in human and mouse, including thymus, spleen, ovary and heart, and on a number of cell types, including activated T- and B-lymphocytes. Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6[1]. Fas receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. It interacts with its ligand to allow the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10[2]. To be specific, the autoproteolytic processing of the caspase in the complex triggers a downstream caspase cascade, including activation of the acidic sphingomyelinase, consumption of sphingomyelin, release of ceramide, and subsequent activation of JNK and p38-K. Thus, Fas receptor acts fucntion via caspase’s regulation and leads to apoptosis[3]. Moreover, the signaling initiated from Fas is mediated by mitogen activated protein kinases (MAPKs) including extracellular-signal-regulated kinase (ERK) and c-Jun N-terminal kinase (JNK) which induce subsequent activation of NF-κB. Meanwhile, stimulation of Fas induced the expression of pro-inflammatory mediators such as matrix metalloproteinase (MMP)-9 and IL-8[4]. The amino acid sequence of human Fas protein has low homology with that of rat and mouse, and the similarity rate is 49.54% and 48.93%, respectively.

In Vivo

Fas (CD95) shows an increase expression in adult rat brain after kainate-induced seizures in rats[5].

Verified Bioactivity

Measured by its ability to inhibit Fas Ligand-induced apoptosis of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 100.3 ng/mL in the presence of 2 ng/mL Human Fas Ligand, corresponding to a specific activity is 9.970×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit Fas Ligand-induced apoptosis of Jurkat human acute T cell leukemia cells. The ED50 for this effect is 100.3 ng/mL in the presence of 2 ng/mL Human Fas Ligand, corresponding to a specific activity is 9.970×103 units/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Fas (Q22-K170)
      Accession # Q63199
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FAS; Fas (TNF Receptor Superfamily, Member 6); Prev. TNFRSF6; Apoptosis Signaling Receptor FAS; Prev. APT1; Apo-1 Antigen; Prev. FAS1; CD95 Antigen; Tumor Necrosis Factor Receptor Superfamily Member 6; Mutant Tumor Necrosis Receptor Superfamily Member 6;

  • AA Sequence

    QGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYK

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00