1. Recombinant Proteins
  2. Enzymes & Regulators
  3. FASN Protein, Human (sf9, His)

FASN (fatty acid synthase) is a multifunctional enzyme that is key to the de novo biosynthesis of long-chain saturated fatty acids from acetyl-CoA and malonyl-CoA using NADPH. This multifunctional protein contains seven catalytic activities and has an acyl carrier protein (ACP) domain with a binding site for the prosthetic group 4'-phosphopantetheine. FASN Protein, Human (sf9, His) is the recombinant human-derived FASN protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FASN (fatty acid synthase) is a multifunctional enzyme that is key to the de novo biosynthesis of long-chain saturated fatty acids from acetyl-CoA and malonyl-CoA using NADPH. This multifunctional protein contains seven catalytic activities and has an acyl carrier protein (ACP) domain with a binding site for the prosthetic group 4'-phosphopantetheine. FASN Protein, Human (sf9, His) is the recombinant human-derived FASN protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

Fatty Acid Synthase (FASN) is a multifunctional enzyme crucial for the de novo biosynthesis of long-chain saturated fatty acids, utilizing acetyl-CoA and malonyl-CoA in the presence of NADPH. This versatile protein possesses seven catalytic activities and a binding site for the prosthetic group 4'-phosphopantetheine of the acyl carrier protein (ACP) domain. Significantly, FASN plays a pivotal role in the replication of SARS coronavirus-2 (SARS-CoV-2), the virus responsible for COVID-19, as its enzymatic activity is required for the viral replication process.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

P49327 (Q1109-G1524, S1438A, P1524G)

Gene ID

2194

Molecular Construction
N-term
8*His
FASN (Q1109-G1524, S1438A, P1524G)
Accession # P49327
C-term
Protein Length

Partial

Synonyms
FASN; Fatty acid synthase; Type I fatty acid synthase; [Acyl-carrier-protein] S-acetyltransferase; [Acyl-carrier-protein] S-malonyltransferase; 3-oxoacyl-[acyl-carrier-protein] synthase; 3-oxoacyl-[acyl-carrier-protein] reductase; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; Enoyl-[acyl-carrier-protein] reductase; Acyl-[acyl-carrier-protein] hydrolase
AA Sequence

QQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQVLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLLSPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVAALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSARPVWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFLLEEDKG

Molecular Weight

47.2 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 10% glycerol, pH 7.5, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FASN Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FASN Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FASN Protein, Human (sf9, His)
Cat. No.:
HY-P701882
Quantity:
MCE Japan Authorized Agent: