FASN Protein, Human (sf9, His)
Based on 1 Customer Validation
FASN (fatty acid synthase) is a multifunctional enzyme that is key to the de novo biosynthesis of long-chain saturated fatty acids from acetyl-CoA and malonyl-CoA using NADPH. This multifunctional protein contains seven catalytic activities and has an acyl carrier protein (ACP) domain with a binding site for the prosthetic group 4'-phosphopantetheine. FASN Protein, Human (sf9, His) is the recombinant human-derived FASN protein, expressed by sf9 insect cells , with N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
FASN (fatty acid synthase) is a multifunctional enzyme that is key to the de novo biosynthesis of long-chain saturated fatty acids from acetyl-CoA and malonyl-CoA using NADPH. This multifunctional protein contains seven catalytic activities and has an acyl carrier protein (ACP) domain with a binding site for the prosthetic group 4'-phosphopantetheine. FASN Protein, Human (sf9, His) is the recombinant human-derived FASN protein, expressed by sf9 insect cells , with N-8*His labeled tag.
Background
Fatty Acid Synthase (FASN) is a multifunctional enzyme crucial for the de novo biosynthesis of long-chain saturated fatty acids, utilizing acetyl-CoA and malonyl-CoA in the presence of NADPH. This versatile protein possesses seven catalytic activities and a binding site for the prosthetic group 4'-phosphopantetheine of the acyl carrier protein (ACP) domain. Significantly, FASN plays a pivotal role in the replication of SARS coronavirus-2 (SARS-CoV-2), the virus responsible for COVID-19, as its enzymatic activity is required for the viral replication process.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-8*His
-
Accession
P49327 (Q1109-G1524, S1438A, P1524G)
-
Gene ID2194
-
Molecular Construction
-
N-term
-
8*His
-
FASN (Q1109-G1524, S1438A, P1524G)
Accession # P49327 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FASN; 3-Oxoacyl-[Acyl-Carrier-Protein] Reductase; Fatty Acid Synthase; 3-Oxoacyl-[Acyl-Carrier-Protein] Synthase; FAS; Enoyl-[Acyl-Carrier-Protein] Reductase; SDR27X1; Acyl-[Acyl-Carrier-Protein] Hydrolase; Short Chain Dehydrogenase/Reductase Family 27X,
-
AA Sequence
QQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQVLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLLSPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVAALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSARPVWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFLLEEDKG
-
Predicted Molecular Mass
47.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 10% glycerol, pH 7.5, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)