Copy Link Print Information

FASN Protein, Human (sf9)

Customer Review

Based on 1 Customer Validation

FASN (fatty acid synthase) is a multifunctional enzyme that is key to the de novo biosynthesis of long-chain saturated fatty acids from acetyl-CoA and malonyl-CoA using NADPH. This multifunctional protein contains seven catalytic activities and has an acyl carrier protein (ACP) domain with a binding site for the prosthetic group 4'-phosphopantetheine. FASN Protein, Human (sf9) is the recombinant human-derived FASN protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • FASN Protein, Human (sf9) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FASN (fatty acid synthase) is a multifunctional enzyme that is key to the de novo biosynthesis of long-chain saturated fatty acids from acetyl-CoA and malonyl-CoA using NADPH. This multifunctional protein contains seven catalytic activities and has an acyl carrier protein (ACP) domain with a binding site for the prosthetic group 4'-phosphopantetheine. FASN Protein, Human (sf9) is the recombinant human-derived FASN protein, expressed by sf9 insect cells , with tag free.

Background

Fatty Acid Synthase (FASN) is a multifunctional enzyme crucial for the de novo biosynthesis of long-chain saturated fatty acids, utilizing acetyl-CoA and malonyl-CoA in the presence of NADPH. This versatile protein possesses seven catalytic activities and a binding site for the prosthetic group 4'-phosphopantetheine of the acyl carrier protein (ACP) domain. Significantly, FASN plays a pivotal role in the replication of SARS coronavirus-2 (SARS-CoV-2), the virus responsible for COVID-19, as its enzymatic activity is required for the viral replication process.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession

    P49327 (Q1109-G1524, S1438A, P1524G)

  • Gene ID
    2194
  • Molecular Construction
    • N-term
    • FASN (Q1109-G1524, S1438A, P1524G)
      Accession # P49327
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FASN; 3-Oxoacyl-[Acyl-Carrier-Protein] Reductase; Fatty Acid Synthase; 3-Oxoacyl-[Acyl-Carrier-Protein] Synthase; FAS; Enoyl-[Acyl-Carrier-Protein] Reductase; SDR27X1; Acyl-[Acyl-Carrier-Protein] Hydrolase; Short Chain Dehydrogenase/Reductase Family 27X,

  • AA Sequence

    QQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQVLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLLSPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVAALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSARPVWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFLLEEDKG

  • Predicted Molecular Mass

    45.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FASN Protein, Human (sf9) Product Image
    1/16
  • FASN Protein, Human (sf9) Product Image