Fc gamma RIIB/CD32b Protein, Human (HEK293, HSA-His)

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, HSA-His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293, with C-HSA and C-His labeled tag.

Fc gamma RIIB/CD32b Protein serves as a receptor for the Fc region of complexed or aggregated immunoglobulins gamma, displaying low affinity. It plays a pivotal role in various effector and regulatory functions, including the phagocytosis of immune complexes and the modulation of antibody production by B-cells. Upon binding to this receptor, there is a down-modulation of the preceding state of cell activation triggered through antigen receptors on B-cells (BCR), T-cells (TCR), or another Fc receptor. Notably, isoform IIB1 is unable to mediate endocytosis or phagocytosis, while isoform IIB2 does not induce phagocytosis. Fc gamma RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN.

Human

HEK293

C-HSA;C-His

P31994-1 (A46-P217)

2213

Extracellular Domain

APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

Approximately 80-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.