1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32
  5. FcγRIIB/CD32b
  6. Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His)

Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His)

Cat. No.: HY-P704599
Handling Instructions Technical Support

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293, with N-SUMO and C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293, with N-SUMO and C-His labeled tag.

Background

Fc gamma RIIB/CD32b Protein serves as a receptor for the Fc region of complexed or aggregated immunoglobulins gamma, displaying low affinity. It plays a pivotal role in various effector and regulatory functions, including the phagocytosis of immune complexes and the modulation of antibody production by B-cells. Upon binding to this receptor, there is a down-modulation of the preceding state of cell activation triggered through antigen receptors on B-cells (BCR), T-cells (TCR), or another Fc receptor. Notably, isoform IIB1 is unable to mediate endocytosis or phagocytosis, while isoform IIB2 does not induce phagocytosis. Fc gamma RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN.

Species

Human

Source

HEK293

Tag

N-SUMO;C-His

Accession

P31994-1 (A46-P217)

Gene ID

2213

Molecular Construction
N-term
SUMO
CD32b (A46-P217)
Accession # P31994-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-b; IgG Fc Receptor II-b; CDw32; Fc-Gamma RII-b; Fc-Gamma-RIIb; FcRII-b; CD32; FCGR2B; FCG2; IGFR2
AA Sequence

APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

Predicted Molecular Mass
32.0 kDa.
Molecular Weight

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His)
Cat. No.:
HY-P704599
Quantity:
MCE Japan Authorized Agent: