Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His)

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293, with N-SUMO and C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (HEK293, SUMO, His) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293, with N-SUMO and C-His labeled tag.

Background

Fc gamma RIIB/CD32b Protein serves as a receptor for the Fc region of complexed or aggregated immunoglobulins gamma, displaying low affinity. It plays a pivotal role in various effector and regulatory functions, including the phagocytosis of immune complexes and the modulation of antibody production by B-cells. Upon binding to this receptor, there is a down-modulation of the preceding state of cell activation triggered through antigen receptors on B-cells (BCR), T-cells (TCR), or another Fc receptor. Notably, isoform IIB1 is unable to mediate endocytosis or phagocytosis, while isoform IIB2 does not induce phagocytosis. Fc gamma RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-SUMO;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • SUMO
    • CD32b (A46-P217)
      Accession # P31994-1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FCGR2B; Fc-Gamma-RIIb; Prev. FCG2; FcGRIIB; Prev. FCGR2; FcRII-B; CD32; IGFR2; CD32B; CDw32; Fc Fragment Of IgG, Low Affinity IIb, Receptor For (CD32); Fc Fragment Of IgG, Low Affinity II, Receptor For (CD32); Low Affinity Immunoglobulin Gamma Fc Region R

  • AA Sequence

    APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

  • Predicted Molecular Mass

    32 kDa

  • Molecular Weight

    Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00