Fc gamma RIIIB/CD16b Protein, Human (NA2, HEK293, His-Avi)
Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (NA2, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (NA2, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The Fc gamma RIIIB/CD16b Protein acts as a receptor for the Fc region of immunoglobulins gamma, exhibiting low affinity and binding to both complexed or aggregated IgG as well as monomeric IgG. In contrast to Fc gamma RIIIA, Fc gamma RIIIB lacks the ability to mediate antibody-dependent cytotoxicity and phagocytosis. Instead, it may function as a trap for immune complexes circulating in the periphery, without activating neutrophils. The protein exists as a monomer and interacts with INPP5D/SHIP1, suggesting its involvement in intracellular signaling pathways associated with immune responses.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
O75015 (G17-S200)
-
Molecular Construction
-
N-term
-
CD16b (G17-S200)
Accession # O75015 -
His-Avi
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FCGR3B; IgG Fc Receptor III-1; Prev. FCGR3; Fc-Gamma RIIIb; Prev. FCG3; CD16-I; FcRIIIb; HNA-1; FcgammaRIIIb; Fc Fragment Of IgG, Low Affinity IIIb, Receptor For (CD16); CD16b; CD16b Antigen; CD16; Fc-Gamma RIII; Low Affinity Immunoglobulin Gamma Fc Regio
-
AA Sequence
GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
-
Predicted Molecular Mass
23.7 kDa
-
Molecular Weight
Approximately 47-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
