FCN2 Protein, Human (P.pastoris, His)
Based on 1 Customer Validation
FCN2 Protein, Human (P.pastoris, His) is the recombinant human-derived FCN2, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FCN2 Protein, Human (P.pastoris, His) is the recombinant human-derived FCN2, expressed by P. pastoris , with N-6*His labeled tag.
Background
FCN2 is a protein that may function in innate immunity by activating the lectin complement pathway. It exhibits calcium-dependent and GlcNAc-binding lectin properties. Research indicates that FCN2 enhances neutrophil phagocytosis of S.typhimurium, suggesting an opsonic effect mediated through its collagen region. by similar: Other lectins with similar functions may participate in immune defense through analogous mechanisms.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
Q15485-1 (L26-A313)
-
Gene ID2220
-
Protein Length
Full Length of Isoform-1
-
Synonyms
FCN2; 37 KDa Elastin-Binding Protein; Ficolin 2; Ficolin-Beta; Ficolin-2; Ficolin B; EBP-37; Hucolin; FCNL; Ficolin (Collagen/Fibrinogen Domain-Containing Lectin) 2 (Hucolin); Collagen/Fibrinogen Domain-Containing Protein 2; Ficolin (Collagen/Fibrinogen D
-
AA Sequence
LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
-
Predicted Molecular Mass
33.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 6% trehalose, pH 7.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
