FCRL2 Protein, Human (HEK293, C-His)
Based on 1 Customer Validation
The FCRL2 protein regulates normal and neoplastic B cell development and has been shown to be involved in complex processes that control B cell maturation. Its tyrosine-phosphorylated isoform 2 interacts with PTPN6, suggesting the existence of a signaling pathway and emphasizing the role of this protein in cellular regulation. FCRL2 Protein, Human (HEK293, C-His) is the recombinant human-derived FCRL2, expressed by HEK293, with C-6*His labeled tag. The total length of FCRL2 Protein, Human (HEK293, C-His) is 376 a.a..
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FCRL2 protein regulates normal and neoplastic B cell development and has been shown to be involved in complex processes that control B cell maturation. Its tyrosine-phosphorylated isoform 2 interacts with PTPN6, suggesting the existence of a signaling pathway and emphasizing the role of this protein in cellular regulation. FCRL2 Protein, Human (HEK293, C-His) is the recombinant human-derived FCRL2, expressed by HEK293, with C-6*His labeled tag. The total length of FCRL2 Protein, Human (HEK293, C-His) is 376 a.a..
Background
The FCRL2 protein appears to have a regulatory role in both normal and neoplastic B cell development, suggesting its involvement in the intricate processes governing B cell maturation and function. Particularly, the tyrosine-phosphorylated isoform 2 of FCRL2 is known to interact with PTPN6, indicating a potential signaling pathway and emphasizing the protein's role in cellular regulation. The specific mechanisms through which FCRL2 influences B cell development and its interaction with PTPN6 remain areas of interest, underscoring the protein's importance in immune system processes and its potential relevance in the context of B cell-related disorders.
Verified Bioactivity
Immobilized Recombinant Human FCRL2 at 4 μg/mL (100 μL/well) can bind Human IgG. The KD for this effect is 76.8 nM.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96LA5-1 (L20-D395)
-
Gene ID79368
-
Protein Length
Partial Extracellular Domain
-
Synonyms
FCRL2; SH2 Domain Containing Phosphatase Anchor Protein 1; Prev. SPAP1; Immunoglobulin Superfamily Fc Receptor, Gp42; FCRH2; Fc Receptor-Like 2; IRTA4; FcR-Like Protein 2; CD307b; CD307b Antigen; Immunoglobulin Receptor Translocation-Associated Protein 4;
-
AA Sequence
LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD
-
Predicted Molecular Mass
41.1 kDa
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
