FCRL2 Protein, Human (HEK293, C-His)

The FCRL2 protein regulates normal and neoplastic B cell development and has been shown to be involved in complex processes that control B cell maturation. Its tyrosine-phosphorylated isoform 2 interacts with PTPN6, suggesting the existence of a signaling pathway and emphasizing the role of this protein in cellular regulation. FCRL2 Protein, Human (HEK293, C-His) is the recombinant human-derived FCRL2, expressed by HEK293, with C-6*His labeled tag. The total length of FCRL2 Protein, Human (HEK293, C-His) is 376 a.a..

The FCRL2 protein appears to have a regulatory role in both normal and neoplastic B cell development, suggesting its involvement in the intricate processes governing B cell maturation and function. Particularly, the tyrosine-phosphorylated isoform 2 of FCRL2 is known to interact with PTPN6, indicating a potential signaling pathway and emphasizing the protein's role in cellular regulation. The specific mechanisms through which FCRL2 influences B cell development and its interaction with PTPN6 remain areas of interest, underscoring the protein's importance in immune system processes and its potential relevance in the context of B cell-related disorders.

Immobilized Recombinant Human FCRL2 at 4 μg/mL (100 μL/well) can bind Human IgG. The KD for this effect is 76.8 nM.

Human

HEK293

C-6*His

Q96LA5-1 (L20-D395)

79368

Partial

LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD

Approximately 55-70 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.