FGF-17 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (His) is the recombinant human-derived FGF-17 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FGF-17 Protein plays a crucial role in embryonic development, serving as a signaling molecule for brain induction and patterning. Its presence is vital for normal brain development, emphasizing its significance in shaping embryogenesis intricacies. FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in signaling cascades that precisely orchestrate developmental events in the embryonic brain. FGF-17 Protein, Human (His) is the recombinant human-derived FGF-17 protein, expressed by E. coli , with N-6*His labeled tag.

Background

FGF-17 Protein assumes a crucial role in regulating embryonic development and serves as a signaling molecule in the induction and patterning of the embryonic brain. Its presence is essential for normal brain development, emphasizing its significance in shaping the intricate processes of embryogenesis. Notably, FGF-17 interacts with FGFR3 and FGFR4, underscoring its involvement in intricate signaling cascades that contribute to the precise orchestration of developmental events in the embryonic brain.

Verified Bioactivity

Measured in a cell proliferation assay using Balb-3T3 mouse fibroblast cells.The ED50 for this effect is 69.02-93.17 ng/mL, corresponding to a specific activity is 1.073×104 to 1.449×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Balb-3T3 mouse fibroblast cells.The ED50 for this effect is 69.02-93.17 ng/mL, corresponding to a specific activity is 1.449×104 to 1.073×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • FGF-17 (T23-T216)
      Accession # O60258
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF17; FGF-17; Fibroblast Growth Factor 17; HH20; FGF-13

  • AA Sequence

    TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

  • Predicted Molecular Mass

    22.5 kDa

  • Molecular Weight

    Approximately 28-30 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00