1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. FGL-1
  5. FGL1 Protein, Rat (sf9, His)

The FGL1 protein is a key immunosuppressant that acts as the primary ligand of LAG3 to inhibit antigen-specific T cell activation. FGL1 is essential for the T cell suppressor function of LAG3, which is independent of MHC class II (MHC-II) binding. FGL1 is secreted by hepatocytes and actively promotes their growth. FGL1 Protein, Rat (sf9, His) is the recombinant rat-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGL1 protein is a key immunosuppressant that acts as the primary ligand of LAG3 to inhibit antigen-specific T cell activation. FGL1 is essential for the T cell suppressor function of LAG3, which is independent of MHC class II (MHC-II) binding. FGL1 is secreted by hepatocytes and actively promotes their growth. FGL1 Protein, Rat (sf9, His) is the recombinant rat-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

FGL1 protein emerges as a pivotal immune suppressive molecule, orchestrating the inhibition of antigen-specific T-cell activation by serving as a primary ligand for LAG3. Its role is crucial in facilitating the T-cell inhibitory function of LAG3 independently of MHC class II (MHC-II) binding. Beyond its immune-modulating functions, FGL1 is secreted by hepatocytes, actively contributing to their growth. Existing in a homodimeric form, FGL1 establishes interactions with LAG3 through its Fibrinogen C-terminal domain, specifically binding to LAG3's Ig-like domains 1 and 2. This intricate molecular interplay positions FGL1 at the nexus of immune regulation and hepatocyte growth, underscoring its significance in the orchestration of T-cell activation and hepatic functions.

Species

Rat

Source

Sf9 insect cells

Tag

C-His

Accession

Q5M8C6 (L23-V314)

Gene ID
Molecular Construction
N-term
FGL1 (L23-V314)
Accession # Q5M8C6
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Fibrinogen-like protein 1; FGL1; HP-041; Hepassocin; HFREP-1; LFIRE-1
AA Sequence

LGDENCLQEQVRLRAQVRQLETRVKQQQVVIAQLLHEKEVQFLDRGQEDSFIDLGGKRHYADCSEIYNDGFKHSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQSNGEYWLGNKNINLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGNCAEEEQSGWWFNRCHSANLNGVYYQGPYRAETDNGVVWYTWRGWWYSLKSVVMKIRPSDFIPNIV

Predicted Molecular Mass
35.5 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGL1 Protein, Rat (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGL1 Protein, Rat (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGL1 Protein, Rat (sf9, His)
Cat. No.:
HY-P75771
Quantity:
MCE Japan Authorized Agent: