FGL1 Protein, Rat (sf9, His)
The FGL1 protein is a key immunosuppressant that acts as the primary ligand of LAG3 to inhibit antigen-specific T cell activation. FGL1 is essential for the T cell suppressor function of LAG3, which is independent of MHC class II (MHC-II) binding. FGL1 is secreted by hepatocytes and actively promotes their growth. FGL1 Protein, Rat (sf9, His) is the recombinant rat-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FGL1 protein is a key immunosuppressant that acts as the primary ligand of LAG3 to inhibit antigen-specific T cell activation. FGL1 is essential for the T cell suppressor function of LAG3, which is independent of MHC class II (MHC-II) binding. FGL1 is secreted by hepatocytes and actively promotes their growth. FGL1 Protein, Rat (sf9, His) is the recombinant rat-derived FGL1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
FGL1 protein emerges as a pivotal immune suppressive molecule, orchestrating the inhibition of antigen-specific T-cell activation by serving as a primary ligand for LAG3. Its role is crucial in facilitating the T-cell inhibitory function of LAG3 independently of MHC class II (MHC-II) binding. Beyond its immune-modulating functions, FGL1 is secreted by hepatocytes, actively contributing to their growth. Existing in a homodimeric form, FGL1 establishes interactions with LAG3 through its Fibrinogen C-terminal domain, specifically binding to LAG3's Ig-like domains 1 and 2. This intricate molecular interplay positions FGL1 at the nexus of immune regulation and hepatocyte growth, underscoring its significance in the orchestration of T-cell activation and hepatic functions.
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q5M8C6 (L23-V314)
-
Molecular Construction
-
N-term
-
FGL1 (L23-V314)
Accession # Q5M8C6 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGL1; Fibrinogen-Like Protein 1; Fibrinogen Like 1; LFIRE-1; HPS; HFREP1; Hepassocin; HP-041; HFREP-1; Hepatocellular Carcinoma-Related Sequence; Hepatocyte-Derived Fibrinogen-Related Protein 1; LFIRE1; Liver Fibrinogen-Related Protein 1
-
AA Sequence
LGDENCLQEQVRLRAQVRQLETRVKQQQVVIAQLLHEKEVQFLDRGQEDSFIDLGGKRHYADCSEIYNDGFKHSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQSNGEYWLGNKNINLLTMQGDYTLKIDLTDFEKNSRFAQYEKFKVGDEKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGNCAEEEQSGWWFNRCHSANLNGVYYQGPYRAETDNGVVWYTWRGWWYSLKSVVMKIRPSDFIPNIV
-
Predicted Molecular Mass
35.5 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
