1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Fluorescent-labeled Recombinant Proteins
  3. Inhibitory Checkpoint Molecules Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Integrin Associated Protein/CD47
  5. FITC-Labeled CD47 Protein, Human (HEK293, His)

FITC-Labeled CD47 Protein, Human (HEK293, His)

Cat. No.: HY-P701266
Handling Instructions Technical Support

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. FITC-Labeled CD47 Protein, Human (HEK293, His) is the recombinant human-derived FITC-Labeled CD47 protein, expressed by HEK293 , with His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. FITC-Labeled CD47 Protein, Human (HEK293, His) is the recombinant human-derived FITC-Labeled CD47 protein, expressed by HEK293 , with His labeled tag.

Background

CD47, an adhesive protein, facilitates cell-to-cell interactions and serves as a receptor for thrombospondin THBS1, modulating integrin signaling through the activation of heterotrimeric G proteins. Involved in diverse cellular processes, CD47 contributes to signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation. Notably, it plays a role in modulating pulmonary endothelin EDN1 signaling and functions as a pressor agent in the regulation of blood pressure in response to THBS1. CD47 is crucial for memory formation and synaptic plasticity in the hippocampus, acting as a receptor for SIRPA and SIRPG, which impacts dendritic cell maturation, cytokine production, cell-cell adhesion, and T-cell activation. Furthermore, CD47 positively modulates FAS-dependent apoptosis in T-cells and suppresses angiogenesis, contributing to metabolic dysregulation during aging. In response to THBS1, CD47 negatively modulates wound healing, inhibits stem cell self-renewal, and may play a role in membrane transport and/or integrin-dependent signal transduction. As a monomer, CD47 interacts with THBS1, SIRPA, FAS/CD95, SIRPG, UBQLN1, UBQLN2, and potentially fibrinogen, highlighting its intricate involvement in cellular and molecular pathways.

Biological Activity

Immobilized FITC-Labeled Human CD47, His Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Human SIRP alpha, hFc Tag with the EC50 of 77.4ng/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q08722-1 (Q19-P139)

Gene ID

961

Protein Length

Extracellular Domain

Synonyms
CD47; MER6; IAP; OA3
AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Weight

45-55 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 6 months from date of receipt, protect from light. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FITC-Labeled CD47 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FITC-Labeled CD47 Protein, Human (HEK293, His)
Cat. No.:
HY-P701266
Quantity:
MCE Japan Authorized Agent: