FITC-Labeled CD70 Trimer Protein, Human (HEK293, His-Flag)

As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. FITC-Labeled CD70 Trimer Protein, Human (HEK293, His-Flag) is the recombinant human-derived FITC-Labeled CD70 Trimer protein, expressed by HEK293 , with His labeled tag.

CD70, a cytokine functioning as the ligand for CD27, is integral to the CD70-CD27 pathway, which holds a crucial role in the development and sustenance of T cell immunity, especially in antiviral responses. Upon binding to CD27, CD70 induces the proliferation of costimulated T-cells and amplifies the generation of cytolytic T-cells, contributing to an effective immune response. Structurally, CD70 forms homotrimers, reflecting its molecular organization. The CD70-CD27 interaction underscores its significance in orchestrating T cell-mediated immune responses, providing valuable insights into the regulation of immune functions.

Human

HEK293

His

P32970-1 (S52-P193)

970

Partial

SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Approximately 50-55 kDa,based on SDS-PAGE under non-reduced conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.