FLI1 Protein, Human (His, Strep)
FLI1 Protein, Human (His, Strep) is the recombinant human-derived FLI1, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
FLI1 Protein, Human (His, Strep) is the recombinant human-derived FLI1, expressed by E. coli , with Strep, His labeled tag.
Background
FLI1 is a sequence-specific transcriptional activator that recognizes the DNA sequence 5'-C[CA]GGAAGT-3'. Its function has been demonstrated in multiple studies, including gene expression regulation. By similar research, FLI1 plays a significant role in transcriptional regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q01543 (P276-N399)
-
Gene ID2313
-
Protein Length
Partial
-
Synonyms
FLI1; Transcription Factor ERGB; Fli-1 Proto-Oncogene, ETS Transcription Factor; Ewing Sarcoma Breakpoint Region 2; SIC-1; ERGB Transcription Factor; EWSR2; ERGB Transcription Fuctor; FLI-1; Proto-Oncogene Fli-1; Friend Leukemia Integration 1 Transcriptio
-
AA Sequence
PGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVN
-
Predicted Molecular Mass
17.7 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)