1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled-10/CD350 Frizzled
  5. Frizzled-10/CD350 Protein, Mouse (HEK293, His)

Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Frizzled-10/CD350 protein is a receptor for Wnt proteins that functions in the canonical Wnt/β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target gene activation. Secondary signaling pathways involve PKC and calcium flux. Frizzled-10/CD350 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-10/CD350 Protein operates as a receptor for Wnt proteins, functioning primarily in the canonical Wnt/beta-catenin signaling pathway. This pathway orchestrates the activation of disheveled proteins, inhibits GSK-3 kinase, facilitates nuclear accumulation of beta-catenin, and triggers the activation of Wnt target genes. Alongside the canonical pathway, a secondary signaling route involving PKC and calcium fluxes has been identified for some family members. The interplay between these pathways and their potential integration remains to be fully elucidated, given PKC's apparent role in Wnt-mediated inactivation of GSK-3 kinase. Frizzled-10 may play a crucial role in transducing and transmitting polarity information during tissue morphogenesis or within differentiated tissues. Interactions with MYOC and WNT7B underscore its involvement in intricate cellular processes and signal transduction cascades.

Biological Activity

Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED50 for this effect is 38.32 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8BKG4/NP_780493.1(I22-G162)

Gene ID
Molecular Construction
N-term
CD350 (I22-G162)
Accession # Q8BKG4/NP_780493.1
His
C-term
Protein Length

Partial

Synonyms
CD350 antigen; CD350; Frizzled-10; FZ-10; FZD10
AA Sequence

ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRG

분자량

Approximately 20-24 kDa due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Frizzled-10/CD350 Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Frizzled-10/CD350 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74144
수량:
MCE Japan Authorized Agent: