FSH beta Protein, Cynomolgus (HEK293, His)
FSH beta Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FSHB protein, expressed by HEK293, with C-His tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FSH beta Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FSHB protein, expressed by HEK293, with C-His tag.
Background
FSHB, together with the alpha chain CGA, forms follitropin (follicle-stimulating hormone) and confers biological specificity to the hormone heterodimer. It binds FSHR, a G protein-coupled receptor, on target cells to activate downstream signaling pathways. Follitropin is involved in follicle development and spermatogenesis in reproductive organs (by similarity).
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
XP_005578391.1 (N19-E129)
-
Gene ID101864888
-
Protein Length
Full Length of Follitropin subunit beta Chain
-
Synonyms
FSHB; Follitropin Beta Chain; Follicle Stimulating Hormone Subunit Beta; FSH-Beta; Follitropin Subunit Beta; FSH-B; Follicle Stimulating Hormone, Beta Polypeptide; Follicle Stimulating Hormone Beta Subunit; Follicle-Stimulating Hormone Beta Subunit; HH24;
-
AA Sequence
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCTFKEVVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFSEMKE
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
