FUOM/Fucose Mutarotase Protein, Human (His)

The FUOM/fucose mutarotase protein has a crucial interconversion effect on α- and β-L-fucose, with β-L-fucose being dominant (70.5%). The β-form undergoes metabolic processes via the salvage pathway, producing GDP-L-fucose that is transported to the endoplasmic reticulum. FUOM/Fucose Mutarotase Protein, Human (His) is the recombinant human-derived FUOM/Fucose Mutarotase protein, expressed by E. coli , with N-His labeled tag.

The FUOM/Fucose Mutarotase Protein plays a crucial role in the interconversion between alpha- and beta-L-fucoses, where L-fucose, a 6-deoxy-L-galactose, coexists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%). Notably, the beta-form undergoes metabolic processes through the salvage pathway. GDP-L-fucose, generated via either the de novo or salvage pathways, is transported to the endoplasmic reticulum. There, it serves as a substrate for N- and O-glycosylations catalyzed by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are thought to play a pivotal role in cell-cell adhesion and recognition processes. The dynamic interconversion facilitated by FUOM highlights its significance in modulating the pool of available L-fucose, influencing essential glycosylation events crucial for various cellular functions.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-His

A2VDF0-1 (M1-L154)

282969  [NCBI]

Full Length of Isoform-1

MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGNLILRKGVLALNPLL

Approximately 19 kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/mda-mb-468-cell.html  [Content Brief]