FUOM/Fucose Mutarotase Protein, Human (His)
Based on 1 Customer Validation
The FUOM/fucose mutarotase protein has a crucial interconversion effect on α- and β-L-fucose, with β-L-fucose being dominant (70.5%). The β-form undergoes metabolic processes via the salvage pathway, producing GDP-L-fucose that is transported to the endoplasmic reticulum. FUOM/Fucose Mutarotase Protein, Human (His) is the recombinant human-derived FUOM/Fucose Mutarotase protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FUOM/fucose mutarotase protein has a crucial interconversion effect on α- and β-L-fucose, with β-L-fucose being dominant (70.5%). The β-form undergoes metabolic processes via the salvage pathway, producing GDP-L-fucose that is transported to the endoplasmic reticulum. FUOM/Fucose Mutarotase Protein, Human (His) is the recombinant human-derived FUOM/Fucose Mutarotase protein, expressed by E. coli , with N-His labeled tag.
Background
The FUOM/Fucose Mutarotase Protein plays a crucial role in the interconversion between alpha- and beta-L-fucoses, where L-fucose, a 6-deoxy-L-galactose, coexists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%). Notably, the beta-form undergoes metabolic processes through the salvage pathway. GDP-L-fucose, generated via either the de novo or salvage pathways, is transported to the endoplasmic reticulum. There, it serves as a substrate for N- and O-glycosylations catalyzed by fucosyltransferases. Fucosylated structures expressed on cell surfaces or secreted in biological fluids are thought to play a pivotal role in cell-cell adhesion and recognition processes. The dynamic interconversion facilitated by FUOM highlights its significance in modulating the pool of available L-fucose, influencing essential glycosylation events crucial for various cellular functions.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
A2VDF0-1 (M1-L154)
-
Molecular Construction
-
N-term
-
His
-
FUOM (M1-L154)
Accession # A2VDF0-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
FUOM; FLJ26016; Prev. C10orf125; Protein FucU Homolog; FucU; L-Fucose Mutarotase; FucM; Fucose Mutarotase; Chromosome 10 Open Reading Frame 125
-
AA Sequence
MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGNLILRKGVLALNPLL
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
