Gag-Pol polyprotein, HIV (440a.a, His)

Customer Review

Based on 1 Customer Validation

The Gag-Pol polyprotein plays a central role in virion assembly, cooperating with Gag to bind to the plasma membrane, promote protein-protein interactions, recruit viral Env proteins, and package genomic RNA through direct interaction with the RNA packaging sequence (Psi). Gag-Pol polyprotein, HIV (440a.a, His) is the recombinant Virus-derived Gag-Pol polyprotein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Gag-Pol polyprotein plays a central role in virion assembly, cooperating with Gag to bind to the plasma membrane, promote protein-protein interactions, recruit viral Env proteins, and package genomic RNA through direct interaction with the RNA packaging sequence (Psi). Gag-Pol polyprotein, HIV (440a.a, His) is the recombinant Virus-derived Gag-Pol polyprotein, expressed by E. coli , with N-6*His labeled tag.

Background

The Gag-Pol polyprotein assumes a central role in the virion assembly process, collaborating with the Gag polyprotein to orchestrate essential events such as binding to the plasma membrane, facilitating protein-protein interactions crucial for spherical particle formation, recruiting viral Env proteins, and packaging genomic RNA through direct interactions with the RNA packaging sequence (Psi). This polyprotein potentially regulates its own translation by binding genomic RNA in the 5'-UTR, exhibiting a dual role in promoting translation at low concentrations and encapsidating genomic RNA to inhibit translation at higher concentrations. The multipartite membrane-binding signal, including the myristoylated N-terminus, targets the polyprotein to the plasma membrane. Additionally, the Matrix protein within the polyprotein is implicated in the pre-integration complex and is associated with the release from the host cell mediated by Vpu. The ability of Gag-Pol to bind to RNA further underscores its multifaceted functions in the intricate process of virion assembly.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • HIV-1 gag-pol (P588-F1027)
      Accession # P04585-1
    • C-term
  • Protein Length

    Full Length of p51 RT Chain

  • Synonyms

    Gag-Pol polyprotein; Pr160Gag-Pol; Matrix protein p17; MA; Capsid protein p24; CA; Spacer peptide 1; SP1; p2; Nucleocapsid protein p7; NC; Transframe peptide; TF; gag-pol

  • AA Sequence

    PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF

  • Molecular Weight

    Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00