Galectin-14/LGALS14 Protein, Human (HEK293, His)

PPL13/LGALS14 is a mammalian placenta-specific galectin with placental specificity. Many placental lectins induce apoptosis of activated T cells and other leukocytes, thereby conferring immune tolerance to the recipient. Galectin-14/LGALS14 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-14/LGALS14 protein, expressed by HEK293 , with C-6*His labeled tag.

PPL13/LGALS14 belongs to the placenta-specific protein family and are proteins secreted by the placenta into the maternal circulation. Human placenta-specific galectin is primarily expressed by the syncytiotrophoblast, the primary site of metabolic exchange. Early in pregnancy, the fetus comes into contact with immune cells circulating in the maternal blood. In ex vivo functional assays, placenta-specific galectin was found to induce T lymphocyte apoptosis, so galectin may reduce the risk of maternal immune attack on fetal semi-allografts and may confer additional immune tolerance. Mechanisms that maintain the hemorrhagic placenta during long gestations in humanoid primates. However, these proteins are reduced along with abnormal placenta before the onset of intrauterine growth restriction (IUGR) or preeclampsia (PE). PPL13 is highly expressed in pregnancies complicated by PE and IUGR. The PPL13 protein binds β-galactoside and lactose and is a strong inducer of T cell apoptosis.

Human

HEK293

C-6*His

AAH22257.1 (M1-D139)

56891  [NCBI]

Full Length

MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Approximately 16 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.