Galectin-4/LGALS4 Protein, Human (His)
Based on 1 Customer Validation
Galectin-4/LGALS4 is a lactose-binding galectin protein with affinity for a variety of sugars. It is associated with the formation of adherens junctions, suggesting its potential role in cell adhesion processes. Galectin-4/LGALS4 Protein, Human (His) is the recombinant human-derived Galectin-4/LGALS4 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Galectin-4/LGALS4 is a lactose-binding galectin protein with affinity for a variety of sugars. It is associated with the formation of adherens junctions, suggesting its potential role in cell adhesion processes. Galectin-4/LGALS4 Protein, Human (His) is the recombinant human-derived Galectin-4/LGALS4 protein, expressed by E. coli , with C-6*His labeled tag.
Galectin-4/LGALS4 is a lactose-binding galectin protein that exhibits an affinity for a variety of sugars. It has been implicated in the formation of adherens junctions, indicating its potential role in cellular adhesion processes. Notably, this protein functions as a monomer, emphasizing its independent molecular state and suggesting that it may exert its biological effects through individual interactions rather than as part of a larger complex.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P56470 (M1-I323)
-
Molecular Construction
-
N-term
-
LGALS4 (M1-I323)
Accession # P56470 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LGALS4; Antigen NY-CO-27; Galectin 4; Galectin-4; GAL4; L36LBP; Lectin, Galactoside-Binding, Soluble, 4; Gal-4; L-36 Lactose-Binding Protein; Galectin; Lactose-Binding Lectin 4
-
AA Sequence
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
-
Predicted Molecular Mass
37.7 kDa
-
Molecular Weight
Approximately 35-38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 5 mM EDTA, 2 mM TCEP, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
