GCGR Protein, Human (HEK293, His)
The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, His) is the recombinant human-derived GCGR protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The GCGR protein is a glucagon G protein-coupled receptor that is critical in blood glucose regulation and actively controls hepatic glucose production. It promotes glycogen hydrolysis and gluconeogenesis, which are critical for the fasting response. GCGR Protein, Human (HEK293, His) is the recombinant human-derived GCGR protein, expressed by HEK293, with C-His labeled tag.
Background
The GCGR Protein serves as a G-protein coupled receptor for glucagon, playing a pivotal role in the regulation of blood glucose levels and glucose homeostasis. It actively regulates hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis, making it a key mediator of responses to fasting. Upon ligand binding, the receptor undergoes a conformational change that initiates signaling via guanine nucleotide-binding proteins (G proteins), subsequently modulating downstream effectors such as adenylate cyclase. This modulation results in the activation of adenylate cyclase. Furthermore, the receptor contributes to signaling via a phosphatidylinositol-calcium second messenger system, underscoring its multifaceted role in glucose regulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P47871 (A26-K136)
-
Gene ID2642
-
Molecular Construction
-
N-term
-
GCGR (A26-K136)
Accession # P47871 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GCGR; GL-R; Glucagon Receptor; MVAH; GGR
-
AA Sequence
AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
-
Predicted Molecular Mass
14.9 kDa.
-
Molecular Weight
Approximately 28-40 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)