GDNF Protein, Human (134a.a, HEK293)
GDNF Protein, Human (134a.a, HEK293) is the recombinant human-derived GDNF protein, expressed by HEK293, with tag free tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GDNF Protein, Human (134a.a, HEK293) is the recombinant human-derived GDNF protein, expressed by HEK293, with tag free tag.
Background
GDNF is a neurotrophic factor that enhances the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. It functions by binding to its coreceptor, GFRA1, leading to autophosphorylation and activation of the RET receptor. Additionally, GDNF is involved in the development of the neural crest. by similar: This functional description is supported by multiple research studies.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P39905-1 (S78-I211)
-
Gene ID2668
-
Molecular Construction
-
N-term
-
GDNF (S78-I211)
Accession # P39905-1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GDNF; ATF2; Glial Cell Derived Neurotrophic Factor; ATF; Astrocyte-Derived Trophic Factor; Glial Cell Line Derived Neurotrophic Factor; Glial Cell Line-Derived Neurotrophic Factor; Glial Derived Neurotrophic Factor; HFB1-GDNF; HSCR3; ATF1; HGDNF
-
AA Sequence
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
-
Predicted Molecular Mass
15.1 kDa
-
Molecular Weight
Approximately 15-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
