1. Recombinant Proteins
  2. Others
  3. GEMIN6 Protein, Human (His, StrepⅡ)

The GEMIN6 protein is a component of the SMN complex and is critical for the assembly of small nuclear ribonucleoproteins (snRNPs), which are essential for spliceosome-mediated pre-mRNA splicing. Most spliceosomal snRNPs share a common set of Sm proteins that form a heptameric protein ring on small nuclear RNAs. GEMIN6 Protein, Human (His, Strep) is the recombinant human-derived GEMIN6 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GEMIN6 protein is a component of the SMN complex and is critical for the assembly of small nuclear ribonucleoproteins (snRNPs), which are essential for spliceosome-mediated pre-mRNA splicing. Most spliceosomal snRNPs share a common set of Sm proteins that form a heptameric protein ring on small nuclear RNAs. GEMIN6 Protein, Human (His, Strep) is the recombinant human-derived GEMIN6 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

GEMIN6, a crucial component of the SMN complex, is integral to the assembly of small nuclear ribonucleoproteins (snRNPs), the essential constituents of the spliceosome that play a central role in pre-mRNA splicing. The majority of spliceosomal snRNPs comprise a common set of Sm proteins, including SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF, and SNRPG, forming a heptameric protein ring on the Sm site of the small nuclear RNA to create the core snRNP (Sm core). In the cytosol, CLNS1A chaperone traps the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF, and SNRPG in an inactive 6S pICln-Sm complex, regulating core snRNP assembly. The SMN complex, consisting of SMN1, GEMIN2/SIP1, DDX20/GEMIN3, GEMIN4, GEMIN5, GEMIN6, GEMIN7, GEMIN8, and STRAP/UNRIP, accepts the trapped 5Sm proteins from CLNS1A to form an intermediate. Binding of snRNA within 5Sm prompts eviction of the SMN complex, allowing SNRPD3 and SNRPB binding to complete the core snRNP assembly. GEMIN6 is part of both the core SMN complex and the SMN-Sm complex, interacting directly with GEMIN7 and GEMIN8, as well as with SNRPB, SNRPD2, SNRPD3, and SNRPE.

Species

Human

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

Q8WXD5 (M1-Q167)

Gene ID

79833

Molecular Construction
N-term
StrepⅡ-6*His
GEMIN6 (M1-Q167)
Accession # Q8WXD5
C-term
Protein Length

Full Length

Synonyms
GEMIN6; Gem-associated protein 6; Gemin-6; SIP2
AA Sequence

MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GEMIN6 Protein, Human (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GEMIN6 Protein, Human (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GEMIN6 Protein, Human (His, StrepⅡ)
Cat. No.:
HY-P701848
Quantity:
MCE Japan Authorized Agent: