GhrA Protein, E.coli (His-SUMO)
GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GhrA is an enzyme involved in cellular metabolism and plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity contributes to the conversion of important metabolites and contributes to metabolic pathways related to glyoxylate detoxification and maintenance of cellular homeostasis. GhrA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived GhrA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
GhrA is an enzyme involved in cellular metabolism, and it plays a crucial role in catalyzing the NADPH-dependent reduction of glyoxylate to glycolate and hydroxypyruvate to glycerate. This enzymatic activity is instrumental in the conversion of important metabolites, contributing to metabolic pathways associated with glyoxylate detoxification and the maintenance of cellular homeostasis.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
B7LFE3 (M1-Y312)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
GhrA (M1-Y312)
Accession # B7LFE3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Glyoxylate/hydroxypyruvate reductase A; EC:1.1.1.79; EC:1.1.1.81; 2-ketoacid reductase; ghrA; EC55989_1146
-
AA Sequence
MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY
-
Predicted Molecular Mass
51.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
