GIPR Protein, Human (HEK293, hFc)
GIPR protein, a receptor for glucose-dependent insulinotropic polypeptide (GIP), operates through G proteins that activate adenylyl cyclase. Its capacity for homodimer and heterodimer formation with GLP1R implies potential interactions between receptors linked to incretin hormones. GIPR Protein, Human (HEK293, hFc) is the recombinant human-derived GIPR protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GIPR protein, a receptor for glucose-dependent insulinotropic polypeptide (GIP), operates through G proteins that activate adenylyl cyclase. Its capacity for homodimer and heterodimer formation with GLP1R implies potential interactions between receptors linked to incretin hormones. GIPR Protein, Human (HEK293, hFc) is the recombinant human-derived GIPR protein, expressed by HEK293, with C-hFc labeled tag.
Background
The GIPR protein functions as a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins, specifically those that activate adenylyl cyclase. Notably, GIPR has the potential to form homodimers and heterodimers with GLP1R, suggesting a possible interaction between receptors associated with incretin hormones.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P48546-1 (G26-Q138)
-
Gene ID2696
-
Molecular Construction
-
N-term
-
GIPR (Gly26-Gln138)
Accession # P48546-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GIPR; GIP-R; Gastric Inhibitory Polypeptide Receptor; PGQTL2; Glucose-Dependent Insulinotropic Polypeptide Receptor
-
AA Sequence
GSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
-
Predicted Molecular Mass
38.9 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
