GIPR Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. GIPR Protein, Mouse (HEK293, His) is the recombinant mouse-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Mouse (HEK293, His) is 116 a.a..

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. GIPR Protein, Mouse (HEK293, His) is the recombinant mouse-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Mouse (HEK293, His) is 116 a.a..

Background

The GIPR protein functions as a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins, specifically those that activate adenylyl cyclase. Notably, GIPR has the potential to form homodimers and heterodimers with GLP1R, suggesting a possible interaction between receptors associated with incretin hormones.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized GIPR, Mouse (HEK293, His) at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody, the EC50 is ≤30 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized GIPR, Mouse (HEK293, His) at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody, the EC50 is 25.62 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GIPR (E19-Q134)
      Accession # Q0P543-1
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    GIPR; GIP-R; Gastric Inhibitory Polypeptide Receptor; PGQTL2; Glucose-Dependent Insulinotropic Polypeptide Receptor

  • AA Sequence

    ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

  • Predicted Molecular Mass

    14.7 kDa

  • Molecular Weight

    Approximately 19-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% Trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% Trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00