1. Recombinant Proteins
  2. Receptor Proteins
  3. GIPR Protein, Mouse (HEK293, His)

AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. GIPR Protein, Mouse (HEK293, His) is the recombinant mouse-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Mouse (HEK293, His) is 116 a.a..

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
1 mg 해외재고보유
> 1 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

AK2 protein plays a key role in cellular energy homeostasis and adenine nucleotide metabolism by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP. Its adenylate kinase activity plays a key role in regulating phosphate utilization and de novo AMP biosynthetic pathways, contributing to the complex balance of cellular energy resources. GIPR Protein, Mouse (HEK293, His) is the recombinant mouse-derived GIPR, expressed by HEK293, with C-10*His labeled tag. The total length of GIPR Protein, Mouse (HEK293, His) is 116 a.a..

Background

The GIPR protein functions as a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins, specifically those that activate adenylyl cyclase. Notably, GIPR has the potential to form homodimers and heterodimers with GLP1R, suggesting a possible interaction between receptors associated with incretin hormones.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized GIPR, Mouse (HEK293, His) at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody, the EC50 is ≤30 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized GIPR, Mouse (HEK293, His) at 2 μg/mL can bind Anti-Mouse Gipr Recombinant Antibody, the EC50 is 25.62 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

Q0P543-1 (E19-Q134)

Gene ID

381853

Molecular Construction
N-term
GIPR (E19-Q134)
Accession # Q0P543-1
10*His
C-term
Protein Length

Extracellular Domain

Synonyms
Gastric inhibitory polypeptide receptor; Glucose-dependent insulinotropic polypeptide receptor
AA Sequence

ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

Predicted Molecular Mass
14.7 kDa
분자량

Approximately 19-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 6% Trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% Trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

GIPR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

GIPR Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
GIPR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P702801
수량:
MCE Japan Authorized Agent: