GLUT1 Protein, Human (sf9, His, N45T, E329Q)

GLUT1 Protein, Human (sf9, His, N45T, E329Q) is the recombinant human-derived GLUT1, expressed by sf9 insect cells , with His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GLUT1 Protein, Human (sf9, His, N45T, E329Q) is the recombinant human-derived GLUT1, expressed by sf9 insect cells , with His labeled tag. ,

Background

Glucose Transporter GLUT1 is a facilitative glucose transporter responsible for constitutive or basal glucose uptake. It exhibits broad substrate specificity, capable of transporting various aldoses, including both pentoses and hexoses. As the primary energy carrier in the brain, GLUT1 is present at the blood-brain barrier and mediates energy-independent, facilitative glucose transport into the brain. In association with BSG and NXNL1, it promotes retinal cone survival by enhancing glucose uptake in photoreceptors (by similar). Additionally, it is required for mesendoderm differentiation (by similar).

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag His
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    SLC2A1; HepG2 Glucose Transporter; Prev. GLUT1; Dystonia Gene 9; Prev. HTLVR; Solute Carrier Family 2, Facilitated Glucose Transporter Member 5; Prev. GLUT; Solute Carrier Family 2 Facilitated Glucose Transporter Member 1; Prev. CSE; Glucose Transporter T

  • AA Sequence

    MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYTQTWVHRYGESILPTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVQRAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV

  • Predicted Molecular Mass

    55.4 kDa

  • Glycosylation

    Yes

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00