GLUT1 Protein, Human (sf9, His, N45T, E329Q)
GLUT1 Protein, Human (sf9, His, N45T, E329Q) is the recombinant human-derived GLUT1, expressed by sf9 insect cells , with His labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GLUT1 Protein, Human (sf9, His, N45T, E329Q) is the recombinant human-derived GLUT1, expressed by sf9 insect cells , with His labeled tag. ,
Background
Glucose Transporter GLUT1 is a facilitative glucose transporter responsible for constitutive or basal glucose uptake. It exhibits broad substrate specificity, capable of transporting various aldoses, including both pentoses and hexoses. As the primary energy carrier in the brain, GLUT1 is present at the blood-brain barrier and mediates energy-independent, facilitative glucose transport into the brain. In association with BSG and NXNL1, it promotes retinal cone survival by enhancing glucose uptake in photoreceptors (by similar). Additionally, it is required for mesendoderm differentiation (by similar).
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His
-
Accession
P11166 (M1-V492, N45T, E329Q)
-
Gene ID6513
-
Protein Length
Full Length
-
Synonyms
SLC2A1; HepG2 Glucose Transporter; Prev. GLUT1; Dystonia Gene 9; Prev. HTLVR; Solute Carrier Family 2, Facilitated Glucose Transporter Member 5; Prev. GLUT; Solute Carrier Family 2 Facilitated Glucose Transporter Member 1; Prev. CSE; Glucose Transporter T
-
AA Sequence
MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYTQTWVHRYGESILPTTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVQRAGRRTLHLIGLAGMAGCAILMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
-
Predicted Molecular Mass
55.4 kDa
-
Glycosylation
Yes
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
