GOX2015 Protein, Gluconobacter oxydans

The GOX2015 protein showed a significant ability to oxidize D-glucose and D-mannose, showing a clear 15-fold preference for the latter. This catalytic efficiency is strictly dependent on the presence of NADP, emphasizing its important role as an oxidative cofactor. GOX2015 Protein, Gluconobacter oxydans is the recombinant GOX2015 protein, expressed by E. coli , with tag free.

GOX2015 Protein exhibits the capability to oxidize both D-glucose and D-mannose, displaying a distinct preference for the latter with a catalytic efficiency approximately 15 times greater than that observed with glucose. This enzymatic activity is strictly reliant on the presence of NADP, emphasizing its crucial role as a cofactor for the oxidation process. The substrate specificity and dependence on NADP underscore the unique biochemical characteristics of GOX2015, shedding light on its potential functional significance in cellular metabolic pathways.

Others

E. coli

Tag Free

Q5FPE5 (P2-S266)

/

Partial

PAPYKDRFAGKKVLVTGASQGIGEATALRFAEEGAQVALNGRKEDKLIAVREKLPKVSGGEHPIATGDISKEDDVKRLVAESIKAMGGLDVLVCNAGYQIPSPSEDIKLEDFEGVMAVNVTGVMLPCREVIRYWLENGIKGTIIVNSSVHQIIPKPHYLGYSASKGAVGNIVRTLALEYATRGIRVNAVAPGAIVTPINMSWIDDPEQYKAVSSHIPMKRPGESREIADAITFLAAEDSTYITGQTLYVDGGLTLYGDFENNWSS

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.