GOX2015 Protein, Gluconobacter oxydans

The GOX2015 protein showed a significant ability to oxidize D-glucose and D-mannose, showing a clear 15-fold preference for the latter. This catalytic efficiency is strictly dependent on the presence of NADP, emphasizing its important role as an oxidative cofactor. GOX2015 Protein, Gluconobacter oxydans is the recombinant GOX2015 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The GOX2015 protein showed a significant ability to oxidize D-glucose and D-mannose, showing a clear 15-fold preference for the latter. This catalytic efficiency is strictly dependent on the presence of NADP, emphasizing its important role as an oxidative cofactor. GOX2015 Protein, Gluconobacter oxydans is the recombinant GOX2015 protein, expressed by E. coli , with tag free.

Background

GOX2015 Protein exhibits the capability to oxidize both D-glucose and D-mannose, displaying a distinct preference for the latter with a catalytic efficiency approximately 15 times greater than that observed with glucose. This enzymatic activity is strictly reliant on the presence of NADP, emphasizing its crucial role as a cofactor for the oxidation process. The substrate specificity and dependence on NADP underscore the unique biochemical characteristics of GOX2015, shedding light on its potential functional significance in cellular metabolic pathways.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GOX2015 (P2-S266)
      Accession # Q5FPE5
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Glucose 1-dehydrogenase; EC:1.1.1.119; GOX2015

  • AA Sequence

    PAPYKDRFAGKKVLVTGASQGIGEATALRFAEEGAQVALNGRKEDKLIAVREKLPKVSGGEHPIATGDISKEDDVKRLVAESIKAMGGLDVLVCNAGYQIPSPSEDIKLEDFEGVMAVNVTGVMLPCREVIRYWLENGIKGTIIVNSSVHQIIPKPHYLGYSASKGAVGNIVRTLALEYATRGIRVNAVAPGAIVTPINMSWIDDPEQYKAVSSHIPMKRPGESREIADAITFLAAEDSTYITGQTLYVDGGLTLYGDFENNWSS

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00