GPA33 Protein, Cynomolgus (HEK293, His)
The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPA33, expressed by HEK293, with C-His labeled tag. The total length of GPA33 Protein, Cynomolgus (HEK293, His) is 214 a.a..
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived GPA33, expressed by HEK293, with C-His labeled tag. The total length of GPA33 Protein, Cynomolgus (HEK293, His) is 214 a.a..
Background
The GPA33 protein is implicated in potentially playing a role in cell-cell recognition and signaling, suggesting its involvement in fundamental cellular processes related to intercellular communication. The precise mechanisms by which GPA33 operates in cell-cell recognition and signaling remain areas of interest, underscoring its potential significance in mediating molecular interactions that contribute to cellular responses. The versatile nature of GPA33 in these processes highlights its potential role in coordinating cellular recognition events and modulating signaling cascades, emphasizing the need for further exploration to elucidate its specific functions and molecular mechanisms.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
G7NU40-1 (I38-V251) I22?
-
Molecular Construction
-
N-term
-
GPA33 (I38-V251)
Accession # G7NU40-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
GPA33; Glycoprotein A33 (Transmembrane); Glycoprotein A33; Cell Surface A33 Antigen; A33; Transmembrane Glycoprotein A33
-
AA Sequence
ITVETSQNVLRALHGKSVTLPCTYHTSTSSREGLIQWDKLLFTHTERVVIWQFSNKDYIYGELYKNRVNISSNVEQSDASITIDQLTMADNGTYECSVSLMSDLDGTTKSRVRLLVLLPPSKPECGIEGETIIGNDIQLTCQSKEGSPTPQYSWKRYDILNQEQPLAQPASGQPVSLKNVSTDTSGYYICTSSNEAGIQFCNITVAVRSPSMNV
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 35-38 kDa & 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
