GPCR 20 variant Protein, Human (Cell-Free, His)
GPCR 20 variant is a member of the G-protein coupled receptor 1 family. GPCR 20 variant Protein, Human (Cell-Free, His) is the recombinant human-derived GPCR 20 variant protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPCR 20 variant is a member of the G-protein coupled receptor 1 family. GPCR 20 variant Protein, Human (Cell-Free, His) is the recombinant human-derived GPCR 20 variant protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Background
GPCR 20 variant belongs to the G-protein coupled receptor 1 family.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q59GP3 (T1-A273)
-
Gene ID2843
-
Molecular Construction
-
N-term
-
10*His
-
GPCR 20 variant (T1-A273)
Accession # Q59GP3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
G-protein coupled receptor 20
-
AA Sequence
TPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
-
Predicted Molecular Mass
35.8 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
