GPR56 Protein-VLP, Human (HEK293)
GPR56 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
GPR56 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Background
GPR56 Protein functions as a receptor pivotal in cell adhesion and likely involved in cell-cell interactions. It plays a crucial role in mediating cell matrix adhesion during the development of neurons and hematopoietic stem cells. In the developing brain, GPR56 acts as a receptor for collagen III/COL3A1, contributing to the regulation of cortical development and playing a specific role in maintaining pial basement membrane integrity and cortical lamination. The interaction with the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway through coupling to GNA13 and possibly GNA12. Additionally, GPR56 is implicated in the maintenance of hematopoietic stem cells and/or leukemia stem cells within the bone marrow niche. Notably, GPR56 assumes a critical role in cancer progression, exhibiting a dual function by inhibiting VEGFA production and angiogenesis through a PRKCA-mediated signaling pathway, as well as activating VEGFA production to promote angiogenesis. Moreover, GPR56 proves essential in testis development, highlighting its diverse and significant contributions to various cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q9Y653-1 (R26-I693)
-
Gene ID9289
-
Molecular Construction
-
N-term
-
GPR56 (R26-I693)
Accession # Q9Y653-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ADGRG1; G-Protein Coupled Receptor 56; Prev. GPR56; Testicular Tissue Protein Li 77; TM7LN4; CDCBM14B; TM7XN1; CDCBM15A; Adhesion G-Protein Coupled Receptor G1; BFPP; G Protein-Coupled Receptor 56; BPPR; Adhesion G Protein-Coupled Receptor G1; 7-Transmemb
-
AA Sequence
RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)