GRM1 Protein, Human (sf9, Flag, His)
GRM1 Protein, Human (sf9, Flag, His) is the recombinant human-derived GRM1, expressed by sf9 insect cells , with His, Flag labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GRM1 Protein, Human (sf9, Flag, His) is the recombinant human-derived GRM1, expressed by sf9 insect cells , with His, Flag labeled tag.
Background
GRM1 is a G-protein coupled receptor for glutamate. Ligand binding induces a conformational change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates downstream effector activity. This signaling activates a phosphatidylinositol-calcium second messenger system. GRM1 may play a central role in glutamate's action in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum. Additionally, it may function in the light response in the retina (by similar). In dopaminergic neurons, GRM1 induces GRID1 and GRID2 cation-channel activation via the GNAQ-PLC-PKC pathway, with a similar effect observed in cerebellar Purkinje cells.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His;Flag
-
Accession
Q13255-1 (I581-V860)
-
Gene ID2911
-
Protein Length
Partial
-
Synonyms
GRM1; Protein Phosphatase 1, Regulatory Subunit 85; Glutamate Metabotropic Receptor 1; Glutamate Receptor, Metabotropic 1; GPRC1A; Metabotropic Glutamate Receptor 1; MGLUR1; SCAR13; PPP1R85; MGluR1; MGlu1; SCA44
-
AA Sequence
IPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHV
-
Predicted Molecular Mass
46.2 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
