GRO-alpha/CXCL1 Protein, Rat

Customer Review

Based on 1 Customer Validation

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1. GRO-alpha/CXCL1 Protein, Rat is produced in E. coli, and consists of 72 amino acids (A25-N96).

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Rat is produced in E. coli, and consists of 72 amino acids (A25-N96).

Background

CXCL1, also known as GRO-α, is a polypeptide that is initially isolated from human melanoma cells. CXCL1 acts as a key chemoattractant for neutrophils by binding specifically to its corresponding G-protein-coupled receptor CXCR2. CXCL1 modulates angiogenesis, tumorigenesis, and wound healing. In general, CXCL1 levels are extremely low under normal physiological conditions and greatly increased during inflammatory conditions[2][3].
The amino acid sequence of human CXCL1 protein has low homology between mouse and rat CXCL1 protein.
After translation, the synthesized CXCL1 precursor is 107aa long. A signal peptide is removed from its N-terminus, which shortens the precursor to 73aa. Two other amino acids can also be removed from the C-terminus. In addition, two disulfide bridges are formed from all four cysteine residues in CXCL1. The disulfide bridges give the appropriate structure to CXCL1, which determines the properties of this chemokine. After secretion, CXCL1 undergoes further proteolytic processing, which regulates the activity of this chemokine. From the N-terminus, three, four or five amino acids are removed, which produce CXCL1(4-73), CXCL1(5-73), and CXCL1(6-73), respectively. This increases CXCL1 activity 30 times, as measured by its ability to induce the chemotaxis of treated cells. To date, three CXCL1 receptors have been discovered-CXCR1, CXCR2 and atypical chemokine receptor 1 (ACKR1). Through NF-κB activation, CXCL1 expression is increased by cytokines such as IL-1β, TNF-α and IL-17. CXCL1 can associate into bioactive dimers and primarily signals through CXCR2/IL-8 RB[1].
After CXCL1 expression is induced by carcinogens, it participates in inflammatory responses by recruiting neutrophils. This leads to chronic inflammation. In addition to increasing proliferation, CXCL1 also induces cancer cell migration, particularly EMT. Produced by lymphatic endothelial cells (LECs), CXCL1 enables tumor cell migration into the lymphatic vessels during lymphangiogenesis, leading to lymph node metastasis. CXCL1 is a chemotactic factor for neutrophils. Additionally, it causes the mobilization of these cells from the bone marrow. CXCL1 can also induce recruitment of regulatory T cells (Treg) and MSCs into the tumor niche. Another no-less-important property of CXCL1 is its ability to induce angiogenesis[1].

In Vitro

Recombinant rat CXCL1 (1 ng/mL; 24 hours) induces migration of rat granulocytes[4].

In Vivo

Recombinant rat CXCL1 (1 ng and 10 ng; once) is administered intrathecally into male Wistar rats. The nociceptive threshold is measured after 3, 5, 7, 24 and 48 hours after its administration. CXCL1 induces spinal nociception. CXCL1 would induce mechanical allodynia by activating the spinal microglia and astrocytes[5].

Verified Bioactivity

1. Full biological activity determined by a chemotaxis bioassay using rat neutrophils is in a concentration range of 10-100 ng/mL.
2. Measured in a cell proliferation assay using human umbilical vein endothelial cells. The ED50 this effect is 16.43 ng/mL, corresponding to a specific activity is 6.0864×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using human umbilical vein endothelial cells. The ED50 for this effect is 16.43 ng/mL, corresponding to a specific activity is 6.0864×104 units/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL1 (A25-K96)
      Accession # P14095
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL1; Neutrophil-Activating Protein 3; Prev. GRO1; Fibroblast Secretory Protein; Prev. MGSA; C-X-C Motif Chemokine 1; Prev. FSP; GRO-Alpha(1-73); SCYB1; GRO1 Oncogene (Melanoma Growth-Stimulating Activity); NAP-3; Melanoma Growth Stimulatory Activity Alp

  • AA Sequence

    APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK

  • Predicted Molecular Mass

    7.9 kDa

  • Molecular Weight

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00