GZMA/Granzyme A Protein, Mouse (His)

GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.

Granzyme A (GZMA) is a highly abundant protease found in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a crucial role in immune defense mechanisms. When delivered into the target cell through the immunological synapse, GZMA activates caspase-independent pyroptosis. It exhibits a substrate specificity for cleavage after lysine or arginine residues. Notably, GZMA cleaves APEX1 after 'Lys-31,' disrupting its oxidative repair activity. Additionally, it targets the nucleosome assembly protein SET, cleaving it after 'Lys-189.' This cleavage event disrupts SET's nucleosome assembly activity and facilitates the translocation of the SET complex into the nucleus, where it is involved in nicking and degrading DNA. The multifunctional activities of GZMA underscore its significance in orchestrating diverse cellular processes during immune responses.

Mouse

E. coli

C-6*His

P11032 (I29-V260)

14938

Full Length of Mature Protein

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.