GZMA/Granzyme A Protein, Mouse (His)
GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GZMA/granzyme A is enriched in cytotoxic T cells and natural killer cells and can induce caspase-independent pyroptosis after delivery to target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and the nucleosome assembly protein SET, thereby disrupting their activity. GZMA/Granzyme A Protein, Mouse (His) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli , with C-6*His labeled tag.
Background
Granzyme A (GZMA) is a highly abundant protease found in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a crucial role in immune defense mechanisms. When delivered into the target cell through the immunological synapse, GZMA activates caspase-independent pyroptosis. It exhibits a substrate specificity for cleavage after lysine or arginine residues. Notably, GZMA cleaves APEX1 after 'Lys-31,' disrupting its oxidative repair activity. Additionally, it targets the nucleosome assembly protein SET, cleaving it after 'Lys-189.' This cleavage event disrupts SET's nucleosome assembly activity and facilitates the translocation of the SET complex into the nucleus, where it is involved in nicking and degrading DNA. The multifunctional activities of GZMA underscore its significance in orchestrating diverse cellular processes during immune responses.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P11032 (I29-V260)
-
Gene ID14938
-
Molecular Construction
-
N-term
-
GZMA (I29-V260)
Accession # P11032 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GZMA; Cytotoxic T-Lymphocyte Proteinase 1; Prev. CTLA3; Granzyme 1; Prev. HFSP; H Factor; CTL Tryptase; HF; Fragmentin-1; Granzyme A (Cytotoxic T-Lymphocyte-Associated Serine Esterase-3; Hanukah Factor Serine Protease); Granzyme A (Granzyme 1, Cytotoxic T
-
AA Sequence
IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
-
Predicted Molecular Mass
32.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
