H2BC4 Protein, Human
H2BC4 Protein, Human is the recombinant human-derived H2BC4, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
H2BC4 Protein, Human is the recombinant human-derived H2BC4, expressed by E. coli , with tag Free labeled tag.
Background
H2BC4 is a core component of the nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to cellular machineries that require DNA as a template. Thus, histones play a central role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. DNA accessibility is regulated through a complex set of post-translational modifications of histones, also known as the histone code, and nucleosome remodeling. by similar: Histones regulate DNA accessibility via post-translational modifications and nucleosome remodeling.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P62807 (M1-K126)
-
Gene ID3017
-
Protein Length
Full Length
-
Synonyms
H2BC5; Histone H2B.K; Prev. HIST1H2BD; DJ221C16.6; Prev. H2BFB; HIST1H2BI; H2B/B; HIST1H2BG; Histone Cluster 1 H2B Family Member D; HIST1H2BF; H2B Histone Family, Member B; HIST1H2BC; HIRA-Interacting Protein 2; HIST1H2BE; Histone Cluster 1, H2bd; H2B.1B;
-
AA Sequence
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
-
Predicted Molecular Mass
13.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)